<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23770
| Description |
Mediator of RNA polymerase II transcription subunit 19a isoform A |
| Sequence | MDPDSKKFGGGPRELTGAVDLLNHFQLLPHFEFFCKRPLPVSISDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYHIQPLDLDILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDVEKKHKKHKDRDKDKDKEHRKHKHRQKDQTKDKEKEKKKDKNRHHDSSADPSKKHHEKKRKHGGDDDLNGVHKHKKVSIRAQKLMNWGQ |
| Length | 214 |
| Position | Head |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.266 |
| Instability index | 30.82 |
| Isoelectric point | 9.42 |
| Molecular weight | 24576.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23770
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.54| 14| 15| 134| 148| 1
---------------------------------------------------------------------------
120- 133 (25.49/ 6.86) KGESKDVEKKHKKH
134- 147 (26.17/ 7.29) KDRDKDKDKEHRKH
152- 165 (23.88/ 6.60) KDQTKDKEKEKKKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.70| 15| 15| 166| 180| 2
---------------------------------------------------------------------------
166- 180 (27.23/14.31) KNRHHDSSADPSKKH
183- 197 (27.46/14.50) KKRKHGGDDDLNGVH
---------------------------------------------------------------------------
|