<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23770

Description Mediator of RNA polymerase II transcription subunit 19a isoform A
SequenceMDPDSKKFGGGPRELTGAVDLLNHFQLLPHFEFFCKRPLPVSISDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYHIQPLDLDILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDVEKKHKKHKDRDKDKDKEHRKHKHRQKDQTKDKEKEKKKDKNRHHDSSADPSKKHHEKKRKHGGDDDLNGVHKHKKVSIRAQKLMNWGQ
Length214
PositionHead
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.05
Grand average of hydropathy-1.266
Instability index30.82
Isoelectric point9.42
Molecular weight24576.56
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23770
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.54|      14|      15|     134|     148|       1
---------------------------------------------------------------------------
  120-  133 (25.49/ 6.86)	KGESKDVEKKHKKH
  134-  147 (26.17/ 7.29)	KDRDKDKDKEHRKH
  152-  165 (23.88/ 6.60)	KDQTKDKEKEKKKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.70|      15|      15|     166|     180|       2
---------------------------------------------------------------------------
  166-  180 (27.23/14.31)	KNRHHDSSADPSKKH
  183-  197 (27.46/14.50)	KKRKHGGDDDLNGVH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23770 with Med19 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AEKGILTVAGKSKGESKDVEKKHKKHKDRDKDKDKEHRKHKHRQKDQTKDKEKEKKKDKNRHHDSSADPSKKHHEKKRKHGGDDDLNGVHKHKKVSIRAQKLMNWGQ
108
214










Molecular Recognition Features






MoRF SequenceStartStop




1) KDVEKKHKKHKDRDKDKDKEHRKHKHRQKDQTKDKEKEKKKDKNRHHDSSADPSKKHHEKKRKHGGDDDLNGVHKHKKVSIRAQKLMNWGQ
124
214