<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23744

Description ATP-dependent DNA helicase
SequenceMKDNLIAISNELLDNGENLNSTQIAKLRHDRSQLNKQIQQLEKYIHSGNLNEERQKSHFSASTAPPTSFVYETPQQTVLCNGSKRYDTQAYMGNETYGSSFQSLPSFSVDNCNMPLGSVGREAFIPKIIEVNYIEGSGDKRWSSYDFPWTKELEVNNKKVFGNHSFRPNQREIINASMSGCDVFVLMPTGGGKSLTYQLPALIRPGITLVISPLVSLIQDQIMHLLQANIPAAYLSANMEWAEQQEILRELNSDYCKYKLLYVTPEKVARSDNLLRHLDNLHFRELLARIVIDEAHCVSQWGHDFRPDYQGLGILKQKFPNTPVLALTATATASVKEDVVQALGLVNCIIFRQSFNRPNLWYSVVPKTKKCLEDIDKFIRVNHFDECGIIYCLSRMDCEKVAEKLQECGHKCAFYHGSMDPAQRASVQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCILYYNYSDYIRVKHMLSQGAIEQSSMTSGYNRSNMINSGRILETNTENLVRMVSYCENDVDCRRLLQLAHFGEKFNSSTCQKTCDNCLKITSFIEKDVTEIANQLVELVKLTGQRFSSSHILEVYRGSLSQMVKKHRHEIVSLHGAGKHLAKGEASRILHHLVVEDFLGEEVKKSDFYGSVSSILKVNEPKVRNLFAGQRIILRFPSSVKASKPGKSDATPAKGSLTSEKLNVMQIDPPSPQTEVDHILSAKLYNALRLLRKSLVTEAGEGVMPHHIFGNATLLLISKRVPRTKEELLDINGIGKAKVSKYGDQLLETIEKTVNEHYKLDNIGSGSKGSADSTKKRRVPNGNSDTNVEDDDAPTKSTGRSKKRTVKRQNRKGVIYDSPEEDYFQGCPDEDLDFDIIEIDALDQVTCKNTAGRVLPQWTAS
Length915
PositionUnknown
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.07
Grand average of hydropathy-0.453
Instability index47.56
Isoelectric point8.27
Molecular weight102947.89
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IEA:InterPro
ATP binding	GO:0005524	IEA:UniProtKB-KW
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA recombination	GO:0006310	IEA:InterPro
DNA repair	GO:0006281	IEA:InterPro
DNA replication	GO:0006260	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.32|      20|      20|     383|     402|       1
---------------------------------------------------------------------------
  383-  402 (39.04/26.75)	HFDECG..IIYCLSRMDCEKVA
  404-  425 (34.28/22.59)	KLQECGhkCAFYHGSMDPAQRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.43|      22|      23|     574|     595|       2
---------------------------------------------------------------------------
  574-  595 (33.14/22.38)	KITSFIEKDVTEI.ANQLVELVK
  597-  619 (31.29/20.75)	TGQRFSSSHILEVyRGSLSQMVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.34|      21|      23|     481|     501|       3
---------------------------------------------------------------------------
  481-  501 (39.30/25.51)	QRSSCILYYNYSDYIRVKHML
  507-  527 (37.04/23.62)	EQSSMTSGYNRSNMINSGRIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.32|      21|      22|     725|     745|       4
---------------------------------------------------------------------------
  725-  745 (34.98/24.53)	SPQTEV.DHILSAKLY.NALRLL
  748-  770 (27.34/17.57)	SLVTEAgEGVMPHHIFgNATLLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.11|      21|      26|     824|     844|       6
---------------------------------------------------------------------------
  824-  844 (35.59/21.37)	SADSTKKRRVPNGNSDTNVED
  851-  871 (35.52/21.32)	STGRSKKRTVKRQNRKGVIYD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.30|      22|      25|     623|     644|      11
---------------------------------------------------------------------------
  623-  644 (37.25/27.59)	HEIVSLHGAGKHLAK....GEASRIL
  645-  670 (31.06/21.66)	HHLVVEDFLGEEVKKsdfyGSVSSIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.33|      26|     138|     164|     189|      12
---------------------------------------------------------------------------
  164-  189 (48.16/31.39)	HSFRPNQR..EIINASMSGCDVFVLMPT
  303-  330 (42.17/26.60)	HDFRPDYQglGILKQKFPNTPVLALTAT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23744 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YKLDNIGSGSKGSADSTKKRRVPNGNSDTNVEDDDAPTKSTGRSKKRTVKRQNRKGVI
812
869










Molecular Recognition Features






MoRF SequenceStartStop




1) RIILRF
685
690