<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23715
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASKIESENSTDTSPSSPKNIYKDPDDGQQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPTNKELAHRQQFYFWKNYRNNRLKHILPRSLPELSATPAAPAPASTSSQAPVSALPPVPATSVAVTATPSQAPSPMPYGMPPGSGLAKNDMRNPTVDNRRKRK |
| Length | 207 |
| Position | Middle |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.650 |
| Instability index | 67.84 |
| Isoelectric point | 9.26 |
| Molecular weight | 23671.61 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23715
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.50| 20| 20| 47| 66| 1
---------------------------------------------------------------------------
29- 42 (16.18/ 7.79) ......QQRFLLELEFVQCL
47- 66 (36.99/26.24) YIHYLAQNRYFEDEAFIGYL
68- 83 (27.34/17.68) YLQYWQRPEYIK...FIMY.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.55| 17| 21| 150| 168| 2
---------------------------------------------------------------------------
150- 168 (24.45/13.79) TSSQAPvSALP...PvPATSVA
172- 191 (30.10/10.87) TPSQAP.SPMPygmP.PGSGLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.84| 14| 22| 97| 110| 3
---------------------------------------------------------------------------
97- 110 (25.83/16.85) NFRNA.MAHPTNKEL
121- 135 (21.00/12.47) NYRNNrLKHILPRSL
---------------------------------------------------------------------------
|