<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23711

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMEGGEGGEGLNQAVQQQLNLKQVKTRAISLFKAISRILEDFEAYGRTNSTPKWQDILGQYSMVNLELFNIVDDIKKVSKAFLVHPKNVNADNATILPVMLSSKLLPEMETDDTAKRDQLLLGMQNLPIPTQIEKLKARLDLISAACEGAEKVLADTRKAYCFGTRQGPAAIAPATLDKGQAAKIQEQENLLRSAVNAGDGLRIPGDQRHITPAQPPLHLADALPVVIANDPTTAQPQPQLSANTMGMPAQNSLLQASSATVSQLLGRSAASPSAATTTTTSFDNITASPIPYANSPRSSTNIMNSPSPQQQQTQQQPPVLQQQQQRQKFMQLPQQQQQHQILAQQQQFRQSAMQGLGQLHGQHQMQFSQPLGHQQFQGRQLPSGHVQHGIGQSQLNQGNQMTRLSQFSGPANSALFSAAQTTPNTQMIPNISGTLPSQSLLPRVQLGLSGNNPQRSHPSQMLSDQVFNMGGGNPGGMMPIQQQQQQQQQHGSQAFGSMASNAQNLQSGLVTLQNTQQNHPNFSQQRQQNPQ
Length531
PositionHead
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.04
Grand average of hydropathy-0.612
Instability index57.50
Isoelectric point9.32
Molecular weight57717.17
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23711
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     146.19|      23|      23|     322|     344|       1
---------------------------------------------------------------------------
  308-  332 (26.87/ 6.55)	PQQQQtQQQppV.....L.....qQQQ........Q.RQKFMQ.L
  333-  356 (29.21/ 7.71)	PQQQQ.QHQ..I.....L.....aQQQ........QfRQSAMQgL
  357-  381 (32.14/ 9.17)	GQLHG.QHQ..MqfsqpLGH....QQF........Q.GR...Q.L
  382-  407 (30.06/ 8.14)	PSGHV.QHG..I......GQsqlnQGN........Q.MTRLSQ.F
  453-  483 (27.91/ 7.07)	PQRSH.PSQ..M.....LSD....QVFnmgggnpgG.MMPIQQ.Q
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.98|      14|      18|     272|     289|       2
---------------------------------------------------------------------------
  272-  289 (18.57/17.71)	PSAATTTTtsfdNITASP
  293-  306 (23.41/11.34)	ANSPRSST....NIMNSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.95|      17|      89|     411|     432|       3
---------------------------------------------------------------------------
  234-  254 (21.21/ 6.89)	AQPQP..QLSAntmGMP....AQNsLL
  419-  441 (18.74/11.32)	AQTTPntQMIP...NISgtlpSQS.LL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.36|      17|      18|     489|     505|       5
---------------------------------------------------------------------------
  486-  502 (28.68/11.46)	QQQQHGSQAFGSMASNA
  503-  519 (27.68/10.80)	QNLQSGLVTLQNTQQNH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     118.77|      40|      48|     131|     173|       6
---------------------------------------------------------------------------
  131-  173 (59.87/43.05)	QIEKLKARLDLISAACEGAE..KVLADTRKaycFGTRQGPAAIA...P
  180-  224 (58.90/33.79)	QAAKIQEQENLLRSAVNAGDglRIPGDQRH...ITPAQPPLHLAdalP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23711 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LRIPGDQRHITPAQPPLHLADALPVVIANDPTTAQPQPQLSANTMGMPAQNSLLQASSATVSQLLGRSAASPSAATTTTTSFDNITASPIPYANSPRSSTNIMNSPSPQQQQTQQQPPVLQQQQQRQKFMQLPQQQQQHQILAQQQQFRQSAMQGLGQLHGQHQMQFSQPLGHQQFQGRQLPSGHVQHGIGQSQLNQGNQMTRLSQFSGPANSALFSAAQTTPNTQMIPNISGTLPSQSLLPRVQLGLSGNNPQRSHPSQMLSDQVFNMGGGNPGGMMPIQQQQQQQQQHGSQAFGSMASNAQNLQSGLVTLQNTQQNHPNFSQQRQQNPQ
201
531










Molecular Recognition Features






MoRF SequenceStartStop




NANANA