<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23705

Description U-box domain-containing protein 33 isoform E
SequenceMKLLDKYLSICRAARVKAAIIVTEADQVQKGIVDLVIKHNIEKLVIGAVPENCMKVKRNSSKANYTAKNAPPFCEVWFIYKGKHIWTREASETPCSSSSCTQPEIAITESLRCRSFQYGKNELFDSEYLWPNSARTTAVSGIRSWVQGEIIETEATFSSKASSCCSHCSPQNSSRAYFDTYLEVMEERINKQLIETKREAEAVTDEAFTELLKCEKLEVEAMEAIRKVNLFESAHVREVKLRKEAEDALRDTVQEQQKLLNESEEIAGELQMTMRNIALLDSRAHEANRRRDEAADELSLIQESISTLWQEGQQIRRQKTEALRWLERWRSRGQVGAAHCNGVIGFAEELPELAEFSLSDLQNATCNFSNSFKIEQGGYGCIYKGEMLGRTVAIKKFHQHNMQGPLEFRQEVQVLGSLQHPHLITLLGVCPEAWSIVYEYLPNGTLQDYLFRKSNNSPLTWNTRARMIAEIASALCFLHSFKPETIIHGDLKPETVLLDSSLGCKMCGFGLCRLVSEESLLRPSFRLSTEPKGAFTYTDPEFQRTGILTTKSDIYSFGLIILQLLTGRTPVGLAVLVRNAVSCGKLSSILDSSAGEWPSAVAMQLVELGLQCCQQYHRDRPELTPTLVRELEQLHASEERPVPSFFSCPILQEIMHDPQVAADGFTYEGDAIREWLENGHDTSPMTNLKLSHLFLTPNYALRLAIQDWLCKS
Length712
PositionTail
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.08
Grand average of hydropathy-0.301
Instability index49.52
Isoelectric point5.77
Molecular weight80428.85
Publications









Function






Annotated function

Functions as an E3 ubiquitin ligase.



GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23705
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.44|      31|      42|      79|     120|       1
---------------------------------------------------------------------------
   79-  109 (57.17/50.02)	IYKGKHIWTREASETPCSS.SSCTQPEIAITE
  123-  154 (51.27/23.72)	LFDSEYLWPNSARTTAVSGiRSWVQGEIIETE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     130.26|      26|      26|     269|     294|       2
---------------------------------------------------------------------------
  185-  207 (20.64/10.25)	...MEERiNKQLIETK.REAEAVTDEA
  220-  245 (33.83/21.43)	EAMEAIR.KVNLFESAHVREVKLRKEA
  269-  294 (41.07/27.56)	ELQMTMR.NIALLDSRAHEANRRRDEA
  297-  322 (34.72/22.18)	ELSLIQE.SISTLWQEGQQIRRQKTEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.86|      19|      25|     556|     574|       4
---------------------------------------------------------------------------
  556-  574 (32.21/19.01)	SFGLI..ILQLLTGRTPVGLA
  582-  602 (29.65/16.98)	SCGKLssILDSSAGEWPSAVA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23705 with Med32 domain of Kingdom Viridiplantae
Unable to open file!