<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23704

Description U-box domain-containing protein 33 isoform A
SequenceMELLKPLHPHHAPILRIPFHAVPSSSSSQSQSQVPLPMIYKVHVAVGKSLDKAVPLLRWTLNHFRNAEIVIVHAYQPSLTIPTLLGKLPASQASPAVVSAFRKVEREQIMKLLDKYLSICRAARVKAAIIVTEADQVQKGIVDLVIKHNIEKLVIGAVPENCMKVKRNSSKANYTAKNAPPFCEVWFIYKGKHIWTREASETPCSSSSCTQPEIAITESLRCRSFQYGKNELFDSEYLWPNSARTTAVSGIRSWVQGEIIETEATFSSKASSCCSHCSPQNSSRAYFDTYLEVMEERINKQLIETKREAEAVTDEAFTELLKCEKLEVEAMEAIRKVNLFESAHVREVKLRKEAEDALRDTVQEQQKLLNESEEIAGELQMTMRNIALLDSRAHEANRRRDEAADELSLIQESISTLWQEGQQIRRQKTEALRWLERWRSRGQVGAAHCNGVIGFAEELPELAEFSLSDLQNATCNFSNSFKIEQGGYGCIYKGEMLGRTVAIKKFHQHNMQGPLEFRQEVQVLGSLQHPHLITLLGVCPEAWSIVYEYLPNGTLQDYLFRKSNNSPLTWNTRARMIAEIASALCFLHSFKPETIIHGDLKPETVLLDSSLGCKMCGFGLCRLVSEESLLRPSFRLSTEPKGAFTYTDPEFQRTGILTTKSDIYSFGLIILQLLTGRTPVGLAVLVRNAVSCGKLSSILDSSAGEWPSAVAMQLVELGLQCCQQYHRDRPELTPTLVRELEQLHASEERPVPSFFSCPILQEIMHDPQVAADGFTYEGDAIREWLENGHDTSPMTNLKLSHLFLTPNYALRLAIQDWLCKS
Length821
PositionTail
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.07
Grand average of hydropathy-0.251
Instability index50.87
Isoelectric point6.35
Molecular weight92475.88
Publications

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23704
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.44|      31|      42|     188|     229|       1
---------------------------------------------------------------------------
  188-  218 (57.17/43.91)	IYKGKHIWTREASETPCSS.SSCTQPEIAITE
  232-  263 (51.27/20.78)	LFDSEYLWPNSARTTAVSGiRSWVQGEIIETE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     130.26|      26|      26|     378|     403|       2
---------------------------------------------------------------------------
  294-  316 (20.64/10.00)	...MEERiNKQLIETK.REAEAVTDEA
  329-  354 (33.83/21.05)	EAMEAIR.KVNLFESAHVREVKLRKEA
  378-  403 (41.07/27.11)	ELQMTMR.NIALLDSRAHEANRRRDEA
  406-  431 (34.72/21.79)	ELSLIQE.SISTLWQEGQQIRRQKTEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.86|      19|      25|     665|     683|       7
---------------------------------------------------------------------------
  665-  683 (32.21/22.60)	SFGLI..ILQLLTGRTPVGLA
  691-  711 (29.65/20.19)	SCGKLssILDSSAGEWPSAVA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23704 with Med32 domain of Kingdom Viridiplantae

Unable to open file!