<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23682

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMEGEGGGEGLNQAVQQQLNLKQVKTRAISLFKAISRILEDFEAYGRTNSTPKWQDILGQYSMVNLELFNIVDDIKKVSKAFVVHPKNVNAENATILPVMLSSKLLPEMETDDTAKRDQLLLGMQNLPIGMQMEKLKARLDLISAACEGAEKVLADTRKAYCFGTRQGPAIAPTLDKGQAAKIQEQENLLRSAVNAGDGLRIPGDQRHITPAQPPLHLADALPVIVNDPTAQPQLSSNTMPAQNSLLQTSSASQLLGRSAASPSGATSTTSFDNTTASPIPYANSPRSSTNMMNTPSPQPQTTQQQPQVQQQQRQKLMQLPKQQQQHHQILAQQQQFRQSAMQGLGQLHGQHQMQFSQPLGHQQFQGRQLPSGHVQHGIGQSQLNQGNQMTRLSQFSGPANSALFSAAQTTPNTQMKEVIANLLNYFDYLGAVLLSSYPPQFLVTRAIALYSTSVDRATILCFLLFQETIFPPKDTQYPVVDRLSMGQPTQLASQYLQIWIRPCNFGINEFPNQPSIPLWIWKRPRDGGVQTHCPNSTNTTIRGLKQSGERPATKTQVSCRSSGDRRQVCGTHALENDAWRNGAWEHVLRFLTLKPLGLRRAERDDLDLGIVGDSSSGISAGAELDHPSGRGIFIGFLGEEMSRDQEVLLKIELHLMIPNISGTLPSQSLLQRTQSVLLERVVLQPVFNMGGGNPGGMMPIQQQQQHGSQAFGSMASNAQNLQSGLVTLQNTQQNHPNFSQQRQQNLQ
Length747
PositionHead
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.05
Grand average of hydropathy-0.477
Instability index47.93
Isoelectric point8.93
Molecular weight82231.14
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23682
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.66|      20|      20|     293|     312|       1
---------------------------------------------------------------------------
  293-  312 (40.76/15.38)	NTPSP...QPQTTQQQPQV..QQ..QQ
  318-  335 (24.15/ 6.31)	QLPKQ...Q....QQHHQIlaQQ..QQ
  720-  744 (23.75/ 6.10)	NLQSGlvtLQNTQQNHPNF..SQqrQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     118.08|      27|      28|     346|     372|       2
---------------------------------------------------------------------------
  345-  371 (51.98/26.26)	G..........QL.HGQHQMQ..FSQPLGHQQFQGRQLPS
  372-  396 (36.54/16.36)	G..........HVqHGIGQSQ..LNQ..GNQMTRLSQF.S
  397-  435 (29.57/11.88)	GpansalfsaaQT.TPNTQMKevIANLLNYFDYLGAVLLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.71|      25|      28|     641|     665|       3
---------------------------------------------------------------------------
  641-  665 (43.12/31.19)	MSRDQEVLLKIELHLMIPNISGTLP
  670-  694 (43.59/31.62)	LQRTQSVLLERVVLQPVFNMGGGNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.07|      20|      20|     493|     512|       6
---------------------------------------------------------------------------
  493-  512 (41.99/28.75)	SQYLQIWIRPCNFGI.NEFPN
  515-  535 (39.09/26.26)	SIPLWIWKRPRDGGVqTHCPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.52|      14|      15|     260|     273|       9
---------------------------------------------------------------------------
  260-  273 (25.61/12.97)	ASP.SGATSTTSFDN
  276-  290 (22.91/10.94)	ASPiPYANSPRSSTN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23682 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SAVNAGDGLRIPGDQRHITPAQPPLHLADALPVIVNDPTAQPQLSSNTMPAQNSLLQTSSASQLLGRSAASPSGATSTTSFDNTTASPIPYANSPRSSTNMMNTPSPQPQTTQQQPQVQQQQRQKLMQLPKQQQQHHQILAQQQQFRQSAMQGLGQLHGQHQMQFSQPLGHQQFQGRQLPSGHVQHGIGQSQL
2) THCPNSTNTTIRGLKQSGERPATKTQVSCRS
191
531
383
561










Molecular Recognition Features






MoRF SequenceStartStop




NANANA