<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23654

Description Mediator of RNA polymerase II transcription subunit 15a isoform C
SequenceMGSYGIQIVVSRVVFNSAHCVCTSLDSTAQTGQSSGGDWQEEVYQKIKSMKESYLPELNEMYQKIASKLQQHDSLPQQPKSDQLEKLKVFKMMLERIITFLQVSKSNISPNFKEKLNSYEKQIINFINTNRPRKNMPGHLPSPHMHSMSQSQPQVTQVQSHENQMNSQLQTTNMQGSVATMQQNNMAAMQHNSLSGVSTAQQSKMNSMQPSTNLDSGPGNAVNSLQQVPVSSLQQNPVSAPQLTNVNSLSSQAGVNVVQPNHNPLQPGSSMLQHQQLKQQQEQQMLQNQQLKQQYQRQLIQRKQQQILQQQQQQQQLHQTAKQQLPAQLPTHQIQQLHQMNDANDIKMRQGISVKPGVFQQPLTSSQRSTYPHQQMKGSPFPVSSPQLLQATSPQIPQHSSPQVDQQNHLPSLTKVATPLQSANSPFMVPTPSPPLAPSPMPGDSEKPISGVSSISNAANIGYQLTGGAAAPAQSLAIGTPGISASPLLAEFTGPDGAHGNALAPTSGKLTVTEQPIERLIKAVKSMSPKALSSAVSDIGSVVSMNDRIAGSAPGNGSRAAVGEDLVAMTNCRLQARNFITQDGANGTRRMKRYTNATPLNVVSSPGSMNDSIKQLTAEASDLDSTATSRFKMPRIEANHSLLEEIREVNQRLIDTVVDISNEEVDPTAAAAAAEGTEGTIVKCSYNAVALGPSLKSQYASAQMSPIQPLHLLVPTNYPNCSPILLDKFPVESSKENEDLSVKAKSRFSISLRSLSQPMSLGEIARTWDVCARIVISEHAQQSGGGSFSSKYGTWENCLTT
Length801
PositionTail
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.04
Grand average of hydropathy-0.540
Instability index60.52
Isoelectric point8.91
Molecular weight87030.07
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats
>MDP23654
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.55|      17|      17|     289|     305|       1
---------------------------------------------------------------------------
  289-  305 (29.60/14.11)	QQLKQQYQRQLIQRKQQ
  335-  351 (22.95/ 8.99)	QQLHQMNDANDIKMRQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     107.06|      26|      29|     170|     197|       2
---------------------------------------------------------------------------
  135-  158 (37.89/15.16)	...NMPGHLPSPHMHSMSQSQ....PQVT...QV
  170-  197 (43.76/24.30)	QttNMQGSVATMQQNNMAAMQH...NSLS...GV
  229-  255 (25.41/ 7.99)	P.......VSSLQQNPVSAPQLtnvNSLSsqaGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     119.54|      29|      29|     451|     479|       3
---------------------------------------------------------------------------
  417-  469 (28.40/14.00)	ATPLQSanspfmvptpsppLApspmpgdsekpIS..........................GVSSISN....AANIGYQLTGGA
  470-  496 (41.88/24.12)	AAPAQS.............LA...........IG..........................T.PGIS.....ASPLLAEFTGPD
  497-  553 (20.72/ 8.23)	GAHGNA.............LA.........ptSGkltvteqpierlikavksmspkalssAVSDIGS....VVSMNDRIAGSA
  554-  585 (28.54/14.10)	PGNGSR.............AA...........VG.........................eDLVAMTNcrlqARNFITQ..DGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.44|      13|      29|     275|     287|       4
---------------------------------------------------------------------------
  275-  287 (24.33/10.84)	QQLKQQQEQQMLQ
  306-  318 (24.12/10.68)	QILQQQQQQQQLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.70|      27|     114|     619|     646|       5
---------------------------------------------------------------------------
  619-  646 (42.03/35.37)	EASDLDSTATSRFKMP..RIEANHSLlEEI
  736-  764 (40.66/28.71)	ENEDLSVKAKSRFSISlrSLSQPMSL.GEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.84|      12|      30|     391|     402|       8
---------------------------------------------------------------------------
  391-  402 (24.03/10.48)	ATSP.QIPQHSSP
  423-  435 (20.81/ 8.05)	ANSPfMVPTPSPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.16|      16|      55|      48|      64|       9
---------------------------------------------------------------------------
   41-   57 (24.24/14.51)	EEVYQK..iKSMKESYLPE
   59-   77 (24.91/10.08)	NEMYQKiasKLQQHDSLPQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23654 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IINFINTNRPRKNMPGHLPSPHMHSMSQSQPQVTQVQSHENQMNSQLQTTNMQGSVATMQQNNMAAMQHNSLSGVSTAQQSKMNSMQPSTNLDSGPGNAVNSLQQVPVSSLQQNPVSAPQLTNVNSLSSQAGVNVVQPNHNPLQPGSSMLQHQQLKQQQEQQMLQNQQLKQQY
2) NFITQDGANGTRRMKRYTNATPLNVVSSPGSM
3) RKQQQILQQQQQQQQLHQTAKQQLPAQLPTHQIQQLHQMNDANDIKMRQGISVKPGVFQQPLTSSQRSTYPHQQMKGSPFPVSSPQLLQATSPQIPQHSSPQVDQQNHLPSLTKVATPLQSANSPFMVPTPSPPLAPSPMPGDSEKPISGVS
123
578
302
295
609
453










Molecular Recognition Features






MoRF SequenceStartStop




NANANA