<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23636

Description Heat shock cognate 70 kDa protein 2 isoform B
SequenceMAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFIDSECLIGDAAKNQVAMNPVNTVYDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSAEEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNRDLFRKCMEPVEKCLRDAKMGKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTFLNNQPGVLIQLYEGERARAKDNNLLGKVEVSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITDKGRLSKDGIEKKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIKDAIESAIQWLDGNQLAEADGLEDKMKELESICNPIIAKMYKAEDEMYRKKVEARHALEKYAYNIRNAINDKGISLKLSPEDKEKINDAVDRALEWLEVTVDADVDEIRRILSSILSSIFSCIAGSNKIKTFWLEELRKFALKAVFLAGKIIGKSSSSLDPPEVGAFKLNCDAFATNIGCCLHPAYGLVKSMHELIKDDDHITWFHALREANQIADCLANFANSLDSHSPNQYQKNDDLKPVHRWIVVKFEYHVRNTIPSILTVGNFDIMSELREKPFAL
Length849
PositionUnknown
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.07
Grand average of hydropathy-0.335
Instability index34.51
Isoelectric point6.08
Molecular weight94247.56
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23636
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     250.56|      70|      83|     520|     601|       1
---------------------------------------------------------------------------
  520-  589 (124.57/92.90)	IEKKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIKDAIESAIQWLDGNQLAEAD
  606-  675 (125.98/73.44)	IAKMYKAEDEMYRKKVEARHALEKYAYNIRNAINDKGISLKLSPEDKEKINDAVDRALEWLEVTVDADVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.32|      23|      26|     458|     482|       8
---------------------------------------------------------------------------
  458-  482 (35.92/28.98)	DNNllGKVEVSGIPPAPRGVPQITV
  487-  509 (37.40/23.72)	DAN..GILNVSAEDKTTGQKNKITI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23636 with Med37 domain of Kingdom Viridiplantae

Unable to open file!