<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23633

Description Heat shock cognate 70 kDa protein 2 isoform A
SequenceMAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFIDSECLIGDAAKNQVAMNPVNTVYDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSAEEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNRDLFRKCMEPVEKCLRDAKMGKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTFLNNQPGVLIQLYEGERARAKDNNLLGKVEVSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITDKGRLSKDGIEKKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIKDAIESAIQWLDGNQLAEADGLEDKMKELESICNPIIAKMYKAEDEMYRKKVEARHALEKYAYNIRNAINDKGISLKLSPEDKEKINDAVDRALEWLEVTVDADVDEIRRILSSILSSIFSCIAGSNKIKTFWLEELRKFALKAVFLAGKIIGFVFERKL
Length729
PositionUnknown
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.07
Grand average of hydropathy-0.337
Instability index32.62
Isoelectric point6.32
Molecular weight80802.54
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23633
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     250.56|      70|      83|     520|     601|       1
---------------------------------------------------------------------------
  520-  589 (124.57/117.45)	IEKKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIKDAIESAIQWLDGNQLAEAD
  606-  675 (125.98/92.92)	IAKMYKAEDEMYRKKVEARHALEKYAYNIRNAINDKGISLKLSPEDKEKINDAVDRALEWLEVTVDADVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.06|      14|      26|     676|     694|       7
---------------------------------------------------------------------------
  676-  694 (13.67/24.59)	EIRRIlssILSSIFscIAG
  705-  718 (23.39/15.25)	ELRKF...ALKAVF..LAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.32|      23|      26|     458|     482|       8
---------------------------------------------------------------------------
  458-  482 (35.92/29.91)	DNNllGKVEVSGIPPAPRGVPQITV
  487-  509 (37.40/24.46)	DAN..GILNVSAEDKTTGQKNKITI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23633 with Med37 domain of Kingdom Viridiplantae
Unable to open file!