<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23632

Description U-box domain-containing protein 33 isoform C
SequenceMAVVSPMPATTQRMGSVRSLSDAGGKFLEEPNPSVVDQPIYVAVTKEVKESRLNLIWAIQNSGGKRICILYVHVRATMVPLLGGKFPASALKEEQVQAYWEEERQGMHRILDDYLRICQRMGVRAEKLHIEMDSIEKGILELISQHGIQKLVMGAASDKYYNRRMMDLKSKKAISVCKQAPASCHIQFVCKGRLIHTRDRSSNEGNADVTSPLVQQVPNSVRSLRSQSVTLGQDRRANLTNPALELFRRVRSANDGHGASFMTVSSPEDTEGFSTPHDRMGTEVSSDESDRLSRMSPSGLSTCSDSAVELAFTPSLINESSENALELTLSRRIIEDLHYSSPPSTLDGGMDDTIYEQLEQARAEAENATLNAYQETVRRRKAEKDAFEAIRKVKASESLYTEELNLRKMTEEKLRKEKEELESMKSLRDKVKEELCLALDQKESLESQIASSELMVKELEQKILSAVDLLQSYKNERDELQMQRDNALREAEELRKKQGEASGTNVPQLFSEFSFSEIKEATSNFNPSSKIGEGGYGSIFKGVLRHTEVAIKMLNSDSMQGPLEFQQEVDVLSKLRHPNLITLIGACPDSWALVYEYLPNGSLEDRLACKNNTPPLSWQARIRIAAELCSALIFLHSSKPHSVVHGDLKPSNILLDANLISKLSDFGICRILSNCESSSSNTTEFWRTDPKGTFVYMDPEFLASGELTPKSDVYSFGIILLRLLTGRPALGITKEVKYALDTGKLKSLLDPLAGDWPFVQAEQLARLALRCCDMNRKSRPDLYSDVWRVLDAMRVSSGGANSFGLSSEGLLQPPSYFICPIFQVNSFVNLCFFSSQHF
Length838
PositionTail
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.06
Grand average of hydropathy-0.380
Instability index51.51
Isoelectric point5.91
Molecular weight93660.48
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23632
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.54|      18|      22|     406|     423|       1
---------------------------------------------------------------------------
  406-  423 (29.66/19.52)	LRKMTEEKL...RKEKEELES
  427-  447 (20.88/11.58)	LRDKVKEELclaLDQKESLES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.24|      15|      15|     298|     312|       2
---------------------------------------------------------------------------
  298-  312 (25.10/16.51)	SGLSTCSDSAVELAF
  315-  329 (23.14/14.61)	SLINESSENALELTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     150.85|      49|      49|     664|     712|       3
---------------------------------------------------------------------------
  593-  631 (28.20/11.37)	................LVY...EYLPNGSLEDRLAcknntpplSW...QAR..IRIAAElCSA
  636-  677 (64.26/34.23)	HSSKPHSVVHGDLKPSNILLDANLIS...............klSD...FGI..CRILSN.CES
  678-  724 (58.40/30.51)	SSSNTTEFWRTDPKGTFVYMDPEFLASGELTPKSD..........vysFGIilLRLL......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.91|      35|     349|     189|     231|       8
---------------------------------------------------------------------------
  189-  231 (54.28/39.38)	VCKGRLIHTrdrssnegNAD.VTSPL.VQQVPNSVRSLRSQS.VTL
  539-  583 (43.62/30.15)	IFKGVLRHT.evaikmlNSDsMQGPLeFQQEVDVLSKLRHPNlITL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.05|      30|      42|      49|      78|       9
---------------------------------------------------------------------------
   49-   78 (52.16/30.50)	KESRLNLIWAIQNSGGKRICILYVHVRATM
   92-  121 (54.89/32.42)	KEEQVQAYWEEERQGMHRILDDYLRICQRM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23632 with Med32 domain of Kingdom Viridiplantae
Unable to open file!