<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23625
Description |
Cyclin-C1-2 isoform C |
Sequence | MAANFWTSSHYKHLLDQEDVDMVNPLDKEKDILKLAQQVKVRQRVVATAITYMRRVYTRKSMTEYDPRLVAPTCLYLASKAEESTVQARLLVFYIKKLYTDDKYRYEIKDILEMEMKILEALNYYLVVYHPYRSLSPLLQDAGLNDLNMTQLTCLHIHC |
Length | 159 |
Position | Kinase |
Organism | Glycine soja (Wild soybean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.267 |
Instability index | 40.74 |
Isoelectric point | 7.70 |
Molecular weight | 18788.67 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23625
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.99| 20| 43| 36| 58| 2
---------------------------------------------------------------------------
36- 58 (28.68/25.14) AQQVKVRQRVVataITYMRRVYT
81- 100 (32.31/20.16) AEESTVQARLL...VFYIKKLYT
---------------------------------------------------------------------------
|