<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23614
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MDSQGQTTSLHRLQNVEKRIVKVLEFAVGVMDELASPIGPRKDVVQNHCLEFMQLIKDISLAVALGSATQIAMFVALAYLLSLPEMKNGGIDPNQKSDSNSRVYIACFNDVLIQLLFSLLNFDQNL |
| Length | 126 |
| Position | Head |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.189 |
| Instability index | 25.60 |
| Isoelectric point | 5.20 |
| Molecular weight | 13967.07 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.68| 16| 24| 24| 39| 1
---------------------------------------------------------------------------
24- 39 (28.16/17.29) LEFAVGVMD.ELASPIG
50- 66 (22.52/12.84) LEFMQLIKDiSLAVALG
---------------------------------------------------------------------------
|