<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23596
| Description |
Uncharacterized protein |
| Sequence | MDSEVKRFGGGPRELTGAVDLISYFKLQPHYDYFCKRPLPVSVADTHYLHNIVGDTEVRKGDGMQLDQLIQNTSNFRETNARLQPFNLDILKEAFQLRETTPVDLPTAEKGIPTIPGKSKSEHKDKEKKHKKHKDRDRDKDKDKEHKKHKHRHKDKDRSKDKEKDKDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDVNDVHKHKKSKHKSSKIDELGAIKVAG |
| Length | 225 |
| Position | Head |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.556 |
| Instability index | 35.88 |
| Isoelectric point | 9.54 |
| Molecular weight | 26079.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23596
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.18| 15| 15| 128| 142| 1
---------------------------------------------------------------------------
128- 142 (28.65/ 8.37) KKHKKHKDRDRDKDK
144- 158 (28.53/ 8.30) KEHKKHKHRHKDKDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.12| 13| 15| 181| 193| 2
---------------------------------------------------------------------------
181- 193 (25.05/ 9.59) DHSKKHHEKKRKH
198- 210 (22.07/ 7.59) DVNDVHKHKKSKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.90| 16| 20| 69| 88| 5
---------------------------------------------------------------------------
69- 88 (22.61/28.86) LIQNTSNFRETNarlqPFNL
90- 105 (26.29/20.13) ILKEAFQLRETT....PVDL
---------------------------------------------------------------------------
|