<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23585

Description Uncharacterized protein
SequenceMAPPRGRGGAGGGFRGRGDRGGRGRGGFGGRGGGDRGTPFKARGGGRGGRGGGRGGGRGGGRGGMKGGSKVVVEPHRHEGIFIAKGKEDALVTKNMVPGEAVYNEKRITVQKEDGTKDEYRVWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDVVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYFLKSGGHFVISIKANCIDSTVPAESVFASEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRVPKKKKDAE
Length309
PositionUnknown
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.07
Grand average of hydropathy-0.434
Instability index27.59
Isoelectric point10.10
Molecular weight32782.96
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
RNA binding	GO:0003723	IEA:UniProtKB-KW

GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:UniProtKB-KW









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23585
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.01|      16|      20|      15|      34|       1
---------------------------------------------------------------------------
   15-   34 (23.75/12.07)	RGrGDRGGrGRGGFggRGGG
   54-   69 (35.25/ 8.11)	RG.GGRGG.GRGGM..KGGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.91|      16|      17|     199|     215|       2
---------------------------------------------------------------------------
  199-  215 (25.67/22.84)	IIEDARHPAKYRMLvGM
  219-  234 (27.24/18.58)	IFSDVAQPDQARIL.GL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.57|      11|      23|      79|      89|       5
---------------------------------------------------------------------------
   79-   89 (19.33/14.04)	EGIF....IAKGKED
  100-  114 (13.24/ 7.45)	EAVYnekrITVQKED
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23585 with Med36 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAPPRGRGGAGGGFRGRGDRGGRGRGGFGGRGGGDRGTPFKARGGGRGGRGGGRGGGRGGGRGGMKGGSKVV
1
72










Molecular Recognition Features






MoRF SequenceStartStop




1) GGFRGRGDRGGRGRGGFGGRGGGDRGTPFKARGGGRGGRGG
12
52