<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23558
| Description |
Uncharacterized protein |
| Sequence | MVPPRGRGGAGGGFRGGRGDRGRGRGGGGGRGTPFKARGGGGRGGGGRGGGRGGRGGMKGGSKVVVEPHRHEGIFIAKGKEDALVTKNLVPGEAVYNEKRITVQKEDGTKDEYRVWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDVVGPNGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLIGMVDVIFSDVAQPDQARILALNASYYLKAGGHLVISIKANCIDSTVPAESVFASEVNKLKAEQFKPFEQVTLEPFERDHACVVGGYRMPKKKKDAE |
| Length | 302 |
| Position | Unknown |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.404 |
| Instability index | 30.95 |
| Isoelectric point | 10.02 |
| Molecular weight | 32100.32 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
| GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP23558
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.45| 12| 15| 5| 16| 1
---------------------------------------------------------------------------
5- 16 (27.76/ 8.67) RGRGGAGGGFRG
21- 32 (26.69/ 8.08) RGRGRGGGGGRG
---------------------------------------------------------------------------
|