<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23554
Description |
Uncharacterized protein |
Sequence | MATPPPMGPPGNPVFDGGPPPPPPTPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWGCNNEQLRMRSVHPLDISQLSKMTGIEYMLSEVLEPHLFVIRKQKRDSPEKVTPMLAYYILDGSIYQAPQLCNVFAARIGRALYYIQKAFTTAASKLEKIGHVDSENETVVTESKVAKETIDLKEVRRVDQILASLQRKLPPAPPPPPFPEGYAPAAAGETDKGPEAQEGAELQVPPGDPIVDQGPAKRMKLM |
Length | 256 |
Position | Head |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.393 |
Instability index | 57.24 |
Isoelectric point | 5.34 |
Molecular weight | 28345.26 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23554
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.79| 14| 202| 5| 21| 1
---------------------------------------------------------------------------
5- 19 (29.39/ 9.36) PPMgPPG.NPV....FDGGP
210- 228 (20.40/ 7.09) PPF.PEGyAPAaageTDKGP
---------------------------------------------------------------------------
|