<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23542
Description |
Uncharacterized protein |
Sequence | MQCEMKFKGYWHANLHILYCELYNFLSRDVFFSFPIKLNRSVLQAKSFDTGSTDSPMELDDMEIEKLEERASSLRKELANKNMHLKILIDQLRDLLSDISTWQSPYST |
Length | 108 |
Position | Head |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.416 |
Instability index | 52.33 |
Isoelectric point | 5.55 |
Molecular weight | 12756.48 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23542
No repeats found
|