<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23537

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQHQIVQSPARLGLTNPNSPSIPNPTPPKLPPSQSHHHQPHLDRHAAGPSAALLSLLPPLPRAQALLQQMASLTSKLFEVSPNRSLWVTAFRGSIPTFLSTQGQAHSSTPHDSSPSTTKEVISQFTILQTQIFEAVAELQEILDLQDAKQKIDREIRSKDSALLAFANKLKDAERCLDILVDDYSDYRRSTKRLKSGDDSEDDSLTSSTVSSQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQLYNFADLDVGLPKVVETKEKTIEAIIEPPPPQQVDANLSAIQGLLPPNFTVPPGWKPGMPVQLPIDLPPPPPGWKPGDPVPLPPMDSLPAPRFEQQQVPHHIPQPKQPEVIQVQHVNLDLDGSDSSDYSSDEASSDDED
Length400
PositionMiddle
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.05
Grand average of hydropathy-0.524
Instability index68.41
Isoelectric point5.08
Molecular weight43750.63
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364141

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23537
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.24|      13|      17|     313|     327|       1
---------------------------------------------------------------------------
  313-  325 (32.30/13.50)	PPGWKPGMPVQLP
  332-  344 (31.94/15.41)	PPGWKPGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.23|      21|      36|     142|     162|       4
---------------------------------------------------------------------------
  142-  162 (34.03/27.05)	EIL..DLQDAKQKIDREIRSKDS
  179-  201 (31.20/24.18)	DILvdDYSDYRRSTKRLKSGDDS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23537 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IVQSPARLGLTNPNSPSIPNPTPPKLPPSQSHHHQPHLDRHAAGPSA
2) WKPGMPVQLPIDLPPPPPGWKPGDPVPLPPMDSLPAPRFEQQQVPHHIPQPKQPEVIQVQHVNLDLDGSDSSDYSSDEASSDDED
6
316
52
400










Molecular Recognition Features






MoRF SequenceStartStop




NANANA