<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23535
| Description |
Uncharacterized protein |
| Sequence | MEEQSVVNGIVSGSSSSRTTQELAMEGQKYLEETIEYAFQILSSMNDELCNPVLWSIASPSAASSASPLHHNNGPSSHSSNGGAGDAASDNSNHHAESGAVGGGAGAGGALEEARFRYKNAIASLRNVLEAIPNSQKAKSFDTGSTDSPMELDDMEIEKLEERASSLRKELANKNMHLKILIDQLRDLLSDISTWQSSLIIVVAHHMYSMSSYTYLATDYGIQLSLFTHHMWIDGFFIVGAVHAAIFILV |
| Length | 250 |
| Position | Head |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.176 |
| Instability index | 48.32 |
| Isoelectric point | 5.01 |
| Molecular weight | 26992.76 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
plastid GO:0009536 IEA:UniProtKB-KW
thylakoid GO:0009579 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | photosynthesis GO:0015979 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23535
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.26| 14| 18| 72| 85| 2
---------------------------------------------------------------------------
72- 85 (26.51/13.00) NNGPSSHSSNGGAG
93- 106 (25.75/12.45) NHHAESGAVGGGAG
---------------------------------------------------------------------------
|