<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23518

Description Uncharacterized protein
SequenceMLRVRVSWKKKNSKNRVGPADRTENRQRKRSDPICKTAKSKTTELAGRIGPEPGRFTKNDLFPSLKGKKLQALSPIPPPFSNSFLQQTLASTNSCRRLLDERLLPPSIALKNFRLRALGPLARSSTSGARISPFSSVLGCSRLPPPVSARAVRVGCCSSSVVVSARFCLPVSLESRLSHWHLVVRLSRRRRQKQLVGLSLASSPSVGWTPTRRRPLLVENLAEVIEHGTPDQQSDALITELSTHFEKCQQLLNSISDSISTKAMTVEGQNKKLEESEQLLNQRRDLIANYRNSVEELVKSEP
Length302
PositionMiddle
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.04
Grand average of hydropathy-0.492
Instability index64.32
Isoelectric point10.69
Molecular weight33648.39
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23518
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.03|      15|      25|     172|     196|       1
---------------------------------------------------------------------------
  172-  191 (22.65/30.71)	SLESRLS.HWhlvvrLSRRRR
  199-  214 (25.38/ 8.82)	SLASSPSvGW.....TPTRRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.42|      24|      25|     105|     128|       2
---------------------------------------------------------------------------
   63-   83 (35.51/17.91)	P...SLKGKKLQALSPI.PPPFSNS
  105-  128 (41.00/21.73)	PPSIALKNFRLRALGPL.ARSSTSG
  133-  155 (33.91/16.80)	PFSSVLGCSRLPP..PVsARAVRVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.08|      18|      19|     234|     251|       3
---------------------------------------------------------------------------
  234-  251 (31.36/22.01)	SDALITELST......HFEKCQQL
  256-  279 (22.71/14.26)	SDSISTKAMTvegqnkKLEESEQL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23518 with Med9 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SWKKKNSKNRVGPADRTENRQRKRSDPICKTAKSKTTELAGRIGPEP
7
53










Molecular Recognition Features






MoRF SequenceStartStop




1) MLRVRVSWKKKN
1
12