<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23515

Description Uncharacterized protein
SequenceMSNNPQYPGLQPLRPPGPPIAGSLDPQRSFVPPPMPGQYRPVVPTQQPQQFMPMPSQHYPPVGPSGPMMNVGMPPQNQQPQFPQPIQQLPPRSGQQLQLPPQPQPLPLSVARPNMHMTSESMMPQPDSQVPNGYAPSLGGPGMPLPASYTFGPSSYGQVQTNFSSASQFHPASQIQAPSSSSSQSITSDTVVLSNDEKPSTTSVTPSATSIQPSLANGGSTDWIEHTSSNGVRYYYNKKTKVSSWERPFELMTPIERVDATTNWKEYTSPNGIKYYYNKVTRESKWMIPEELKVYTIKNNATFNILFHLFSASYLTEISFPQILSIKLARQQVEKAVANGTHTDALPNSHTQPSVTPPVIETAPTAAANSSLIGQGEPSSPVSVAPVVSASTSHPQSEMSSGPSASPHVAPITGMAVAEVELPVNTATISDAAAGSDRASVTNQNDGNNFLVKDTLGSADEVPAEDKEDGKNDSLVEKTNDVASETKADTVSETRADLASETQANVALETKADASSETKTREPLPLVYANKMEAKEAFKALIESVNVGSDWTWDRTMRLIVNDKRYGALKSLGEKKQAFNEYLSHRKKQEAEEKRMKHKKAREDFKKMLEESTELNPSTRWSKAVTIFENDERFKAVERDRDRRDMFDSFLEELINKERAKAQEERKRNITEYRKLLESCDFIKANTQWRKVQDRLEADERCSRLEKIDRLEIFQDYLRDLEKEEEEQKKLLKEELRKTERKNRDEFRKLMEEHVAAGILTAKTHWRDYHMKVKDLPAYLAVASNTSGSTAKDLFEDVAEELEKQYHDEKSRIKDAVKLAKITWSSTYTFEEFKSALSIDSPPISDFNLKLVFDELLERAKEKEEKEAKKRKRLADDFLHLLYSTKDITASSKWEDCITLIEDSQEFRSVGDDNRCKEIFEEYITQLKEQAKEGERKRKEERAKKEKDREEKERRKSKQRREKEGVREREKDKADSDSADLTEKGDSKNKRRQHQSPEHTSHELDKERSKKSHGHSSSDRKKSKRHSSGHESDEGRHKRHKRDHRGDPHREGGYAEAEDDDYGKDVDRW
Length1069
PositionUnknown
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.07
Grand average of hydropathy-1.022
Instability index57.08
Isoelectric point6.32
Molecular weight121184.54
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23515
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      58.46|      14|      15|    1016|    1029|       1
---------------------------------------------------------------------------
 1000- 1013 (17.53/ 7.39)	TSHEL.DKERSKKSH
 1016- 1029 (23.81/13.12)	SSSDR.KKSKRHSSG
 1032- 1046 (17.11/ 7.01)	SDEGRhKRHKRDHRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     165.37|      17|      17|      74|      90|       2
---------------------------------------------------------------------------
   25-   41 (24.75/12.08)	DPQR..SfvPP...PMPGQYR..P
   44-   60 (31.92/18.11)	PTQQ..P..QQFM.PMPSQHY..P
   74-   90 (36.19/21.69)	PPQN..Q..QPQF.PQPIQQL..P
   91-  107 (26.12/13.23)	PRSG..Q..QLQLpPQP.QPL..P
  113-  131 (23.93/11.39)	PNMHmtS..ESMM.PQPDSQV..P
  135-  153 (22.46/10.15)	APSL..G..GPGM.PLPASYTfgP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.07|      15|      15|     483|     497|       3
---------------------------------------------------------------------------
  483-  497 (26.23/16.00)	ASETKADTVSETRAD
  499-  513 (23.84/13.86)	ASETQANVALETKAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     127.47|      31|      38|     221|     257|       4
---------------------------------------------------------------------------
  221-  251 (63.29/54.21)	TDWIEHTSSNGVRYYYNKKTKVSSWERPFEL
  262-  292 (64.18/39.87)	TNWKEYTSPNGIKYYYNKVTRESKWMIPEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.67|      11|      15|     158|     168|       6
---------------------------------------------------------------------------
  158-  168 (19.83/11.27)	QVQTNFSSASQ
  174-  184 (19.83/11.27)	QIQAPSSSSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.15|      16|      16|     719|     734|       7
---------------------------------------------------------------------------
  639-  653 (25.01/10.51)	RDRD.R.RDMFDSFLEE
  719-  734 (24.58/10.22)	RDLE.KEEEEQKKLLKE
  737-  753 (23.56/ 9.56)	RKTErKNRDEFRKLMEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.78|      19|      21|     437|     455|       8
---------------------------------------------------------------------------
  437-  455 (32.93/21.82)	DRASVTNQNDG.NNFLVKDT
  460-  479 (27.85/17.23)	DEVPAEDKEDGkNDSLVEKT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.29|      20|      21|     352|     371|       9
---------------------------------------------------------------------------
  352-  371 (35.55/20.29)	Q......PSVTPPVIETAPTAAANSS
  377-  393 (27.99/14.43)	E......PS..SPV.SVAPVVSASTS
  396-  419 (19.75/ 8.02)	QsemssgPSASPHVAPITGMAVAE..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     217.56|      39|      60|     600|     638|      10
---------------------------------------------------------------------------
  533-  569 (50.23/25.84)	..............................EAK......E.......AFKALI.ESVNVGSDWTWDRTMRLIVN.........DKRYG.AL
  570-  637 (47.20/23.87)	KslgekkqafneylshrkkqeaeekrmkhkKAR......E.......DFKKMLEESTELNPSTRWSKAVTIFEN.........DERFK.AV
  638-  705 (38.91/18.50)	E.......rdrdrrdmfdsfleelinkeraKAQ......EerkrnitEYRKLLESCDFIKANTQWRKVQDRLEA.........DERCS.RL
  803-  837 (44.28/21.98)	E.............................KQY......H.......DEKSRIKDAVKLAKIT.WSSTYT.F............EEFKsAL
  866-  917 (36.93/17.22)	K.............................EAKkrkrlaD.......DFLHLLYSTKDITASSKWEDCITLIEDsqefrsvgdDNRCK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.90|      17|      79|     969|     986|      11
---------------------------------------------------------------------------
  949-  965 (27.32/15.63)	RE.EKERRKSKQRREKEG
  969-  986 (22.58/16.96)	REkDKADSDSADLTEKGD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23515 with Med35 domain of Kingdom Viridiplantae
Unable to open file!