<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23508
| Description |
Uncharacterized protein |
| Sequence | MDLDDFRSILDTAGVDVWLFIDTAITVASLDCGDELRRRRDGIIERIFAATTPPLPCRNCDGDRNLRSNGYQIKKRLSPSPSPQRQHSHHQQRRGGRGAAAAVSPSTPQSLGDDDDNGHADAAEDDREDLDPYGGLFDDEQKKILEIKEQLEEPDQSEESLVELLQNLADMDITFQALKETDIGRHVNRLRKHSSNDVRRLVKLLVRKWKEIVDEWVRLNQPGGTASLMADGDSPPLKTTQNGHHQVFFGPFFFNIMIPDFAYSPNPHNGSSGSDRNTSEAEPKPKVIPRKEAPPKPTPPPSVPTPSIAFQNRQREQRDRDFDAERLASARKRLQENYKEAENAKKQRTIQVMDIHELPKSKPKNAFFGKNKGSGGSQGRHW |
| Length | 382 |
| Position | Unknown |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.959 |
| Instability index | 53.21 |
| Isoelectric point | 6.44 |
| Molecular weight | 43061.43 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23508
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.00| 24| 27| 32| 58| 1
---------------------------------------------------------------------------
32- 58 (41.65/38.75) C.GD.ELRRRRDGIIERIfaaTTPPLPCR
60- 85 (37.35/25.43) CdGDrNLRSNGYQIKKRL...SPSPSPQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.44| 21| 21| 96| 116| 3
---------------------------------------------------------------------------
96- 116 (36.25/18.10) GRGAAAAVSPSTPQSLGD..DDD
118- 140 (33.19/16.04) GHADAAEDDREDLDPYGGlfDDE
---------------------------------------------------------------------------
|