<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23501
| Description |
Uncharacterized protein |
| Sequence | MNSDSHQEWKKYFEGAECNIFDVIHNAIDVAALDYPKMFKHRRSKIMEKLYSVLQVCETYHYSNNNVKGDKIECANSNKLLDGGNNNDKVGDTKVIGFNQNTSNYTIEETEELGNRIEDEYHNIRHILEIKERLYNHHKETETEIVNLLRVLSLIVQSVGEIHATNIRPTVNVLQYHWSRKVTEAALKTTKYESCHLCPCNLII |
| Length | 204 |
| Position | Unknown |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.606 |
| Instability index | 60.72 |
| Isoelectric point | 6.12 |
| Molecular weight | 23696.46 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23501
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.67| 15| 20| 64| 78| 1
---------------------------------------------------------------------------
64- 78 (29.11/22.53) NNNVK.GD.KIECANSN
85- 101 (20.56/13.85) NNNDKvGDtKVIGFNQN
---------------------------------------------------------------------------
|