<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23496

Description Uncharacterized protein
SequenceMEVCGGMRPWGEVVVEVTKAAQKKETDAVLWAVEVYSNLKAAGESLPSLELAEVLVSYICWDNNVPILWKFLEKALLLNFVPPIFLLSLLSLRVIPCRRSQPAAYRLYLELLRRHAFQLKSHINTPNYPNCLMHRWMTRDCWNSLLKRSPDGEHCTKKWNGMKIIALRRLSFMNSCKMQILLRLLRLLGNLCRTKPAHWFSFVQRLQLLAANSSALRNSGTLSPEAFLQLTSDKYMVLTRECKTSSQQKFHAVMGFEYLSSSASLCHGASHSAIWIPLDLVLEDAMDGYQVSTTSGIEIISGLVRTLRAINGTSWHDTFLGLWLAALRLVQREREPIEGPMPRLDTRLCMLLGIIPIVIADLIEEEERTPVDETETGPTDQWKEERVPGKCRNDLVSTCSLHLKSVVAYANQAAAKAMLFVSGITPGSAYFDCLGMKEMPIDCSGNMHHLIVEACIARGLLDTSAYLWPGYVNGRINQLPQCMQAQVPGWASFMKGAPLTSVMANALVSSPASSLAELEKIFKVATGGSEDEKIFAASILCGASLIRGWNIQEHTVQFIIRLLSPSKPAENTEGYNHLINYARLINVVIVGIAPVDCVQIFSLHGLVPTLACSLMPICEVFGSCVPNVSWKLTSGEEISAHAVFSNAFILLLRLWRFDRPPLEHGIGDVPTVGSQLTPEYLLLVRNSHLMSTSSVHNDRNRMRLSTIASLSSPDSVFVDSFPKLKAWYRQHQACIASTLSGLVHGTPFHQIVEGLLNMMTKKINRGNQNSITISGSSSSSGPGNDDASLRPKLPAWDILEAIPFVVDAALTACAHGRLSPRELAIGMCFNQINPREHTKYVLKYLFYVTEDNLFPNLKNLPKLVKTSLYLASKIRLSNIQVDVP
Length884
PositionTail
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.08
Grand average of hydropathy0.069
Instability index43.11
Isoelectric point8.52
Molecular weight98265.19
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
regulation of phenylpropanoid metabolic process	GO:2000762	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23496
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.23|      28|      41|     399|     439|       8
---------------------------------------------------------------------------
  399-  430 (38.60/56.07)	CSLHLKSVVayANQAAAKAMLFVSG.ITPGsaY
  443-  471 (48.63/27.30)	CSGNMHHLI..VEACIARGLLDTSAyLWPG..Y
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.88|      30|      71|     698|     727|      11
---------------------------------------------------------------------------
  698-  727 (52.97/31.21)	DRNRMRLSTIASLSSPDSVFVDSFPKLKAW
  767-  796 (53.91/31.88)	NQNSITISGSSSSSGPGNDDASLRPKLPAW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.77|      10|      37|     331|     340|      12
---------------------------------------------------------------------------
  331-  340 (19.81/14.04)	QREREPIE....GP
  365-  378 (13.96/ 7.51)	EEERTPVDetetGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.23|      18|      20|     206|     225|      13
---------------------------------------------------------------------------
  206-  223 (28.33/20.49)	LQLLAANSSAL.RNSGTLS
  228-  246 (26.90/11.57)	LQLTSDKYMVLtRECKTSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.14|      16|      20|     584|     601|      16
---------------------------------------------------------------------------
  584-  601 (18.63/21.66)	LINVVIVGIAPVdCvQIF
  606-  621 (29.51/20.28)	LVPTLACSLMPI.C.EVF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23496 with Med33 domain of Kingdom Viridiplantae

Unable to open file!