<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23496

Description Uncharacterized protein
SequenceMEVCGGMRPWGEVVVEVTKAAQKKETDAVLWAVEVYSNLKAAGESLPSLELAEVLVSYICWDNNVPILWKFLEKALLLNFVPPIFLLSLLSLRVIPCRRSQPAAYRLYLELLRRHAFQLKSHINTPNYPNCLMHRWMTRDCWNSLLKRSPDGEHCTKKWNGMKIIALRRLSFMNSCKMQILLRLLRLLGNLCRTKPAHWFSFVQRLQLLAANSSALRNSGTLSPEAFLQLTSDKYMVLTRECKTSSQQKFHAVMGFEYLSSSASLCHGASHSAIWIPLDLVLEDAMDGYQVSTTSGIEIISGLVRTLRAINGTSWHDTFLGLWLAALRLVQREREPIEGPMPRLDTRLCMLLGIIPIVIADLIEEEERTPVDETETGPTDQWKEERVPGKCRNDLVSTCSLHLKSVVAYANQAAAKAMLFVSGITPGSAYFDCLGMKEMPIDCSGNMHHLIVEACIARGLLDTSAYLWPGYVNGRINQLPQCMQAQVPGWASFMKGAPLTSVMANALVSSPASSLAELEKIFKVATGGSEDEKIFAASILCGASLIRGWNIQEHTVQFIIRLLSPSKPAENTEGYNHLINYARLINVVIVGIAPVDCVQIFSLHGLVPTLACSLMPICEVFGSCVPNVSWKLTSGEEISAHAVFSNAFILLLRLWRFDRPPLEHGIGDVPTVGSQLTPEYLLLVRNSHLMSTSSVHNDRNRMRLSTIASLSSPDSVFVDSFPKLKAWYRQHQACIASTLSGLVHGTPFHQIVEGLLNMMTKKINRGNQNSITISGSSSSSGPGNDDASLRPKLPAWDILEAIPFVVDAALTACAHGRLSPRELAIGMCFNQINPREHTKYVLKYLFYVTEDNLFPNLKNLPKLVKTSLYLASKIRLSNIQVDVP
Length884
PositionTail
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.08
Grand average of hydropathy0.069
Instability index43.11
Isoelectric point8.52
Molecular weight98265.19
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
regulation of phenylpropanoid metabolic process	GO:2000762	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23496
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.23|      28|      41|     399|     439|       8
---------------------------------------------------------------------------
  399-  430 (38.60/56.07)	CSLHLKSVVayANQAAAKAMLFVSG.ITPGsaY
  443-  471 (48.63/27.30)	CSGNMHHLI..VEACIARGLLDTSAyLWPG..Y
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.88|      30|      71|     698|     727|      11
---------------------------------------------------------------------------
  698-  727 (52.97/31.21)	DRNRMRLSTIASLSSPDSVFVDSFPKLKAW
  767-  796 (53.91/31.88)	NQNSITISGSSSSSGPGNDDASLRPKLPAW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.77|      10|      37|     331|     340|      12
---------------------------------------------------------------------------
  331-  340 (19.81/14.04)	QREREPIE....GP
  365-  378 (13.96/ 7.51)	EEERTPVDetetGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.23|      18|      20|     206|     225|      13
---------------------------------------------------------------------------
  206-  223 (28.33/20.49)	LQLLAANSSAL.RNSGTLS
  228-  246 (26.90/11.57)	LQLTSDKYMVLtRECKTSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.14|      16|      20|     584|     601|      16
---------------------------------------------------------------------------
  584-  601 (18.63/21.66)	LINVVIVGIAPVdCvQIF
  606-  621 (29.51/20.28)	LVPTLACSLMPI.C.EVF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23496 with Med33 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
NANANA

Molecular Recognition Features

MoRF SequenceStartStop
NANANA