<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23483

Description Uncharacterized protein
SequenceMVNLELFNIVDEIKKVSKAFLVYPKNVNAENATILPVMLSSKLLPEMETEDSSKRDQLLQGMQNLPIPTQIEKLKARIDMIAAACEGAEKVLADTRKAYCFGTRQGPTITPTLDKGQAAKIQEQENLLRAAVNTGLRIPPDQRQITPTLPMHLAEAFTPNEGAQSFPDASNNSMYMKNTPLSSNSMGGQNPMVQASGSQLLGRSAASPSAATSATSFDNTTASPLPYANSPRSSASMMNAPSPQQQTQQQQQQQQSPVQAQQRQKLMQLPQQQQQQLLAQQQQFRQSAMQGLGQLHGQHQMQFSQSLGHQQFQGRQLASGHVQHGIGQSQLTQGNQITRLGQFSGAANSALFSAAQTTPNTQMIPNISATMSSRMQFGLPGNNPQRSHATQMLGDQMFNLGSGNPGGMMSIQQQQQLGSQGAFGGMASNAQNLQSNMVTLQNSQQNHPNFNQQRQQNPQQ
Length460
PositionHead
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.04
Grand average of hydropathy-0.670
Instability index56.47
Isoelectric point9.51
Molecular weight50036.57
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      82.49|      16|      18|     272|     287|       2
---------------------------------------------------------------------------
  244-  259 (30.18/ 8.78)	QQQTQQQ..QQQQQSPVQ
  281-  298 (25.63/ 6.41)	QQQFRQSamQGLGQLHGQ
  447-  460 (26.69/ 6.96)	HPNF..N..QQRQQNPQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     145.82|      45|     138|     181|     237|       3
---------------------------------------------------------------------------
  160-  191 (34.37/19.05)	...................NEGAQSFPDASN..NSMYMkntplSSN...SMGGQNP
  201-  237 (47.54/19.64)	LGR.SAASPSAATSATSFDNTTASPLPYANSprSSASM..................
  340-  384 (63.92/21.38)	LGQfSGAANSALFSAAQTTPNT.QMIPNI.....SATM.....SSRmqfGLPGNNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.60|      38|      45|      60|      97|       5
---------------------------------------------------------------------------
   60-   97 (62.62/41.29)	QGMQNLPI..PTQIEKLKARIDMIAAACEGAEKVLADTRK
  105-  144 (58.99/38.46)	QGPTITPTldKGQAAKIQEQENLLRAAVNTGLRIPPDQRQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23483 with Med8 domain of Kingdom Viridiplantae

Unable to open file!