<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23482
| Description |
Uncharacterized protein |
| Sequence | MDSEVKRFGGGPRELTGAVDLISYFKLQPHYDYFCKRPLPVSVADTHYLHNIVGDTEVRKGDGMQLDQLIQNTSNFRETNARLQPFNLDILKEAFQLRETTPVDLPTAEKGIPTIPGKSKSEHKDKEKKHKKHKDRDRDKDKDKEHKKHKHRHKDKDRSKDKEKDKDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDVNDVHKHKKSKFALFLIWLLSFVKVWWHLHLKLTDFVRLGSVLTKIER |
| Length | 246 |
| Position | Head |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.275 |
| Instability index | 34.75 |
| Isoelectric point | 9.63 |
| Molecular weight | 28953.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23482
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.72| 13| 15| 165| 177| 3
---------------------------------------------------------------------------
165- 177 (23.22/ 9.95) DKDKKK.DKSGHRD
181- 194 (18.50/ 6.36) DHSKKHhEKKRKHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.84| 14| 18| 71| 88| 6
---------------------------------------------------------------------------
71- 88 (20.08/23.93) QNTSNFRETNarlqPFNL
92- 105 (23.76/15.96) KEAFQLRETT....PVDL
---------------------------------------------------------------------------
|