<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23480

Description Uncharacterized protein
SequenceMAVVSPMSPAMATTPHQVYPTTPLRGSEVPLIMSGLREAAEASSPNVVDDIIHVAVAKDVKDSRLNLIWAIQNSGGKRICILYVHVPAATIPIMGANFPESAAGEHRVQEHRENEEQGMRNILNDYLLICRRMGVEAEKLHIVDKDCIEKGIVELICKHNIKKLVMGAASDKYHSRRMTELRSRKAIYVRENAPAYCHIQFICKGYLIYTRNLSLDGGNVEVRSPLAPQTPSRSPSLGQQLYRRVRSVNERNGGRMSLASPIRFLMQPNRFGREGTSNGSDVLSRPASPLVSSRSSVNFISEPSENASALNSSSPNAIQASPSRLDSEMDETLYDQLQQAMAEAENARQDAYQESIRRGNAERNAIEAIRRAKAAEMKYEKEVKLRKELEEAIKREKEEIDCMKSQREKLNEELQHALHKNSLLESKIASTQLMLEELDQKNKSAMDTLEKYKQEREDLQTQRDNALKEAEELRREKQGEASTSHVFQLFSEFSFAEIKEATNNFSPSQKIGEGGYGSIYKGILRQTEVAVKMLSPDSKQGPKEFQQEVEVLSKLRHPNLITLIGTCPESWTLVYEYLSNGSLEDRLSCEDNTPPLSWQTRIRIAAEVCSTLVCLHSNKPHSIVHGDLKPANILLDANLVSKLSDFGISRLLSCREDSTTQFWITDPKGTFAYMDPEFFASGELTPKSDVYSFGIILLKLLTGKPAVGIAKVVESALVAGKLNSLLDPLAGDWPLALAEKLARLALRCCEMERRNRPDLHLEVWRILEPMKASLSGENTLGLGSQELCQPPPYFICPIFKNLTCSCFQEVMRDPHMAADGHTYEAEAIRGWLDSGRDTSPVTNSKLVMHNLVPNHALRYAIQDWLES
Length867
PositionTail
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.06
Grand average of hydropathy-0.435
Instability index52.92
Isoelectric point6.29
Molecular weight97115.60
Publications

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      76.20|      23|      24|     367|     390|       1
---------------------------------------------------------------------------
  367-  382 (19.27/ 8.16)	.......EAIRRAKAA..EMKYEKE
  384-  408 (33.57/21.18)	KLRKELEEAIKREKEEidCMKSQRE
  409-  427 (23.37/ 8.23)	KLNEELQHALHKNSLL..ESK....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     138.81|      32|      32|     237|     268|       2
---------------------------------------------------------------------------
  205-  231 (39.62/22.79)	.GYLIYTRNLSLD...GGNV.EVRSPLA.PQTP
  237-  268 (54.21/33.94)	LGQQLYRRVRSVNERNGGRM.SLASPIRFLMQP
  271-  303 (44.99/26.89)	FGREGTSNGSDVLSRPASPLvSSRSSVNFISEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.14|      11|      23|     587|     597|       3
---------------------------------------------------------------------------
  587-  597 (20.91/12.76)	LSCEDNTPPLS
  612-  622 (21.23/13.07)	LVCLHSNKPHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.23|      20|      24|     436|     457|       4
---------------------------------------------------------------------------
  438-  457 (31.70/21.47)	LDQKNKSAMDTLEKYKQERE
  459-  478 (30.53/14.00)	LQTQRDNALKEAEELRREKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.16|      12|      26|     501|     512|       5
---------------------------------------------------------------------------
  501-  512 (21.89/16.56)	ATNNFSPSQKIG
  530-  541 (21.27/15.85)	AVKMLSPDSKQG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23480 with Med32 domain of Kingdom Viridiplantae

Unable to open file!