<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23477
Description |
Uncharacterized protein |
Sequence | MAPPRGRGGAGGGFRGRGDRGGRGRGGFGGRGGDRGTPFKARGGGRGGRGGGRGGGRGGGRGGMKGGSKVVVEPHRHEGIFIAKGKEDALVTKNMVPGEAVYNEKRITVQKEDGTKDEYRVWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDVVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYFLKSGGHFVISIKANCIDSTVPAESVFASEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRVPKKKKDAE |
Length | 308 |
Position | Unknown |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.434 |
Instability index | 27.24 |
Isoelectric point | 10.10 |
Molecular weight | 32725.91 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
Repeats |
>MDP23477
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.29| 14| 17| 23| 36| 1
---------------------------------------------------------------------------
5- 16 (26.97/ 7.73) RGRGGAGG..GFRG
23- 36 (33.05/10.95) RGRGGFGGRGGDRG
42- 54 (30.26/ 9.47) RG.GGRGGRGGGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.03| 17| 18| 189| 205| 2
---------------------------------------------------------------------------
169- 192 (20.30/10.54) TGVVYAVEfshrsgrDLVNMAKKR
193- 209 (30.72/18.91) TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
|