Description | Uncharacterized protein |
Sequence | MQREVRAKVRTQKSEAHIDPKCKVRTQKETKAVPSRFCCAARRSCRSVESSGKKVESCSAAVLIVDVDRYARDFMEAAKKLQLHFISLQREDKPTKVEMLRKDITLMEEELDRKNELIKKQESLVLEWKKELKEQMDKHKTELERV |
Length | 146 |
Position | Head |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.864 |
Instability index | 43.38 |
Isoelectric point | 9.40 |
Molecular weight | 17175.83 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP23470 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.11| 16| 16| 88| 103| 1 --------------------------------------------------------------------------- 88- 103 (26.62/13.20) LQREDKPTKVEMLRKD 106- 121 (25.48/12.41) LMEEELDRKNELIKKQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DVDRYARDF 2) IDPKCKVR 3) VLEWKKEL 4) VPSRFCCAARRSCRSVESS | 66 18 125 33 | 74 25 132 51 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab