<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23441
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQHQIVQSPARLGLTNPNSPSIPNPTPPKLPPSQSHHHQPHLDRHAAGPSAALLSLLPPLPRAQALLQQMASLTSKLFEVSPNRSLWVTAFRGSIPTFLSTQGQAHSSTPHDSSPSTTKGVISQFTILQTQIFEAVAELQEILDLQDAKQKIDREIRSKDSALLAFANKLKDAERCLDILVDDYSDYRRSTKRLKSGDDSEDDSLTSSTVSSQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQLYNFADLDVGLPKVVETKEKTIEAIIEPPPPQQVDANLSAIQGLLPPNFTVPPGWKPGMPVQLPIDLPLPPPGWKPGDPVPLPPMDSLPAPRFEQQQVPHHIPQPKQPEVIQVQHVNLDLDGSDSSDYSTYKETSL |
| Length | 397 |
| Position | Middle |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.470 |
| Instability index | 66.70 |
| Isoelectric point | 5.63 |
| Molecular weight | 43466.63 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23441
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.24| 13| 17| 313| 327| 1
---------------------------------------------------------------------------
313- 325 (32.30/11.80) PPGWKPGMPVQLP
332- 344 (31.94/13.49) PPGWKPGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.13| 14| 16| 276| 291| 3
---------------------------------------------------------------------------
276- 290 (18.69/16.52) VETKEKTIEAIIePP
295- 308 (23.44/ 9.22) VDANLSAIQGLL.PP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.35| 29| 335| 15| 44| 5
---------------------------------------------------------------------------
12- 40 (54.46/21.53) RLGLTNPNSPSIPNPTPPKLPPSQSHHHQ
42- 70 (47.89/14.86) HLDRHAAGPSAALLSLLPPLPRAQALLQQ
---------------------------------------------------------------------------
|