<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23436
| Description |
Uncharacterized protein |
| Sequence | MVNRIRETLRRHLRVSGPEGSQELWKIARRFEEKIFAAASSQTDYRRKIYLKVFTIMETMYQGSQEPANPVDTNPRQHGSRNRRMPAWTDDYHMG |
| Length | 95 |
| Position | Tail |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -1.016 |
| Instability index | 66.82 |
| Isoelectric point | 10.18 |
| Molecular weight | 11297.68 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23436
No repeats found
No repeats found
|