<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23430

Description Uncharacterized protein
SequenceMSNNPQYPGLQPLRPPGPPIAGSLDPQRSFVPAPMPGQYRPVVSTQQPQQFMPMPSQHYPPVGPSGPMMNVGMPPQNQQPQFPQPIQQLPPRPGQQLQLPPQPQPLPLSVARPNMHMTSESMMPQPDSQVPNGYAPSLGGPGMPLPASYTFGPSSYGQVQTNFSSASQFHPASQIQAPSSSSSQSITSDTVVLSNDEKPSTTSVTPSATGIQPSLANGGSTDWIEHTSSNGVRYYYNKKTKVSSWERPFELMTPIERVDATTNWKEYTSPNGIKYYHNKVTRESKWMIPEELKVYTIKNNATFNILFHLFSASYLTEIPFPQILSIKLARQQVEKAVANGTHTDALPNSHTQPSVTPPVIETAPTAAANSSLIGQGEPSSPVSVAPVVSASTSHPQSEMSSGPSASPHVAPITGMTVAEVELPVNTATISDAAAGSDRASVTNQNDGNNFLVKDTLGSADEVPAEDKEDGKNDSLVEKTNDVASETKADTVSETRADLASETQANVALETKADASSETKTREPLPLVYANKMEAKEAFKALIESVNVGSDWTWDRTMRLIVNDKRYGALKSLGEKKQAFNEYLSQRKKQEAEEKRMKHKKAREDFKKMLEESTELNPSTRWSKAVTIFENDERFKAVERDRDRRDMFDSFLEELINKERAKAQEERKRNITEYRKLLESCDFIKANTQWRKVQDRLEADERCSRLEKIDRLEIFQDYLRDLEKEEEEQKKLLKEELRKTERKNRDEFRKLMEEHVAAGILTAKTHWRDYHMKVKDLPAYLAVASNTSGSTAKDLFEDVAEELEKQYHDEKSRIKDAVKLAKITWSSTYTFEEFKSALSIDSPPISDFNLKLVFDELLERAKEKEEKEAKKRKRLADDFLHLLYSTKDITASSKWEDCITLIEDSQEFRSVGDDNRCKEIFEEYITQLKEQAKEGERKRKEERAKKEKDREEKERRKSKQRREKEGVREREKDKADSDSADLTEKGDSKNKRRQHQSPEHTSHELDKERSKKSHGHSSSDRKKSKRHSSGHESDEGRHKRHKRDHRGDPHREGGYAEAEDDDYGKDVDRW
Length1069
PositionUnknown
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.06
Grand average of hydropathy-1.023
Instability index56.92
Isoelectric point6.32
Molecular weight121133.49
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23430
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     176.76|      31|      38|     221|     251|       1
---------------------------------------------------------------------------
  152-  171 (23.52/ 9.49)	..........GPSSYGQVQTNFSS.ASQFHP
  172-  202 (40.02/21.32)	ASQIQAPSSSSSQSITSDTVVLSNDEKPSTT
  221-  251 (57.72/34.00)	TDWIEHTSSNGVRYYYNKKTKVSSWERPFEL
  262-  292 (55.50/32.41)	TNWKEYTSPNGIKYYHNKVTRESKWMIPEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      58.46|      14|      15|    1016|    1029|       2
---------------------------------------------------------------------------
 1000- 1013 (17.53/ 6.63)	TSHEL.DKERSKKSH
 1016- 1029 (23.81/11.88)	SSSDR.KKSKRHSSG
 1032- 1046 (17.11/ 6.28)	SDEGRhKRHKRDHRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     145.00|      15|      18|      34|      48|       3
---------------------------------------------------------------------------
   34-   48 (31.53/16.92)	P...MPGQYRPVVSTQQ...P
   53-   67 (31.29/16.73)	P...MPSQHYPPVGPSG...P
   72-   80 (18.95/ 6.97)	G...MPPQ......NQQ...P
   83-  100 (25.16/11.88)	P...QPIQQLPPRPGQQlqlP
  103-  113 (19.82/ 7.66)	P...QP...LP.LSVAR...P
  126-  141 (18.25/ 6.42)	PdsqVPNGYAP..SLGG...P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     404.30|      77|      79|     616|     694|       4
---------------------------------------------------------------------------
  553-  610 (81.67/52.54)	....WDRTMRLIVNDKRYG.ALKSLGEKKQAFNEYL..S.....QRKKQEAE.....EKR..............MKHKKARE.....DF.......K....KMLE
  617-  694 (129.30/94.74)	PSTRWSKAVTIFENDERFK.AVERDRDRRDMFDSFL..EELInKERAKAQEE.....RKR............NITEYRKLLE...SCDFIKANTQWR....KVQD
  698-  775 (65.38/40.33)	.............ADERCS.RLEK.IDRLEIFQDYL..RDL.....EKEEEE.....QKKllkeelrkterkNRDEFRKLMEehvAAGILTAKTHWRdyhmKVKD
  823-  889 (63.86/39.19)	..T.WSSTYT.FEE...FKsALSIDSPPISDFNLKLvfDELL..ERAKEKEEkeakkRKR............LADDFLHLLY...STKDIT..............
  890-  938 (64.09/36.36)	ASSKWEDCITLIEDSQEFR.SVGDDNRCKEIFEEYI..TQL..KEQAK.EGE.....RKR.............................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.57|      14|      21|     477|     495|       5
---------------------------------------------------------------------------
  482-  495 (25.39/22.74)	VASETKADTVSETR
  506-  519 (24.19/ 8.39)	VALETKADASSETK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.64|      18|      20|     375|     392|       6
---------------------------------------------------------------------------
  375-  392 (31.30/13.85)	QGEPSSPVSVAPVVSAST
  396-  413 (29.35/12.58)	QSEMSSGPSASPHVAPIT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      71.38|      18|      18|     940|     957|       7
---------------------------------------------------------------------------
  940-  957 (26.89/14.00)	EERAKKEKDRE.EKER..RKS
  958-  978 (18.80/ 7.48)	KQRREKEGVRErEKDKadSDS
  979-  996 (25.69/13.04)	ADLTEKGDSKN.KRRQ..HQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.24|      19|      20|     431|     449|       8
---------------------------------------------------------------------------
  431-  449 (31.62/18.82)	DAAAGSDRASVTNQNDGNN
  454-  472 (31.61/18.81)	DTLGSADEVPAEDKEDGKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.62|      16|      19|     333|     349|       9
---------------------------------------------------------------------------
  333-  349 (23.27/17.35)	VEKAVANGTHTDAlPNS
  355-  370 (27.35/15.83)	VTPPVIETAPTAA.ANS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23430 with Med35 domain of Kingdom Viridiplantae

Unable to open file!