<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23429
| Description |
Uncharacterized protein |
| Sequence | MEEQSVVNGIVSGSSSSRTTQELAMEGQKYLEETIEYAFQILSSMNDELCNPVLWSIASPSAASSASPLHHNNGPSSHSSNGGAGDAASDNSNHHAESGAVGGGAGAGGALEEARFRYKNAIASLRNVLEAIPNSQKNLKTNHFYAKSFDTGSTDSPMELDDMEIEKLEERASSLRKELANKNMHLKILIDQLRDLLSDISTWQSPYST |
| Length | 209 |
| Position | Head |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.552 |
| Instability index | 56.26 |
| Isoelectric point | 4.94 |
| Molecular weight | 22475.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.26| 14| 19| 72| 85| 1
---------------------------------------------------------------------------
72- 85 (26.51/14.12) NNGPSSHSSNGGAG
93- 106 (25.75/13.52) NHHAESGAVGGGAG
---------------------------------------------------------------------------
|