<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23426
Description |
Uncharacterized protein |
Sequence | MLGQKIFTLLLAKIKQLRTGIWELLSDYPFKLICIRAGDAAELLITRQAYGKEHKVCLRQWEFYPLLLENQHNMVKKRIYWNEKADLIRMFFFGVPVNVDLMDTNNWRPNQGAEPIMDNNDWRSQLQPESRQRIVNKIMDTLKRHLPVSGQEGLHELRKIAQRFEEKIFTAATSQPDYLRKISLKMLTMETKNPGNMAGNLPSNQGGTSNKPPDPVDPCQMFLR |
Length | 224 |
Position | Tail |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.521 |
Instability index | 37.34 |
Isoelectric point | 9.44 |
Molecular weight | 26084.04 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23426
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.82| 16| 21| 157| 176| 1
---------------------------------------------------------------------------
157- 176 (22.24/24.78) LRKIAQrfeeKIFTAATSQP
179- 194 (28.57/18.87) LRKISL....KMLTMETKNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.53| 16| 21| 33| 48| 2
---------------------------------------------------------------------------
33- 48 (26.82/14.88) ICIRAGDAAELLITRQ
56- 71 (30.72/17.83) VCLRQWEFYPLLLENQ
---------------------------------------------------------------------------
|