<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23423

Description Uncharacterized protein
SequenceMMRRCWLKGFPLSLGKSWEQSLSFIKKKKLNVDQHTKYLCSKHDNMAAFVTREGGTRHCDRGTEDIVLVPYFSLRSNSSIITAVMDTSNWRDELQPAFRQRFFNNILHNLQLGHPPESFDEILEFHKIAHSIEQKSYAGATSQAEYVMQIARKMLLLEKAREREWRDYFCPDSRQRIVYKIMKLLKRHLDVTDPEGSQELWRIAERLEEKIFSKADTETDYLRKITIKMHKMENTPRRSH
Length240
PositionTail
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.10
Grand average of hydropathy-0.699
Instability index54.16
Isoelectric point9.37
Molecular weight28508.46
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23423
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.33|      14|      14|      94|     107|       1
---------------------------------------------------------------------------
   94-  107 (25.64/17.18)	LQPAFRQRFFNNIL
  110-  123 (25.68/17.21)	LQLGHPPESFDEIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     135.15|      40|      73|     124|     163|       2
---------------------------------------------------------------------------
  124-  163 (66.32/46.91)	EFHKIAHSIEQKSYAGATSQAEYVMQIARKMLLLEKARER
  199-  238 (68.82/48.93)	ELWRIAERLEEKIFSKADTETDYLRKITIKMHKMENTPRR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23423 with Med15 domain of Kingdom Viridiplantae

Unable to open file!