<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23416

Description Uncharacterized protein
SequenceMWLPRSQQEKDGVNGLVAVAIDKEKGSRNALQWAIDHLLNKGATVILIHVKINSNSAPSFTPRSFTGFITGKESIGREPDAQNKSIFLPYRVFCTRKDIQCKDVLIEDVDVAKAIVEYATQAGIEHLVLGSSSKTGLLKRFKVSDIPGSVTKGAPDFCTVYVVSKGKIQSMRSASRPAPPSVVQLSSEQTNLQVQMPPGWREHERFSYEGTPHRSQEGTTEFRSPFTRKGYHDRYTEHSAPDLDISFVSNGRPSSERMVPSFYTAETTTSYSNPRFSYSSEPDTNYSFESVPQRRSLDASLPAEFPSIISFENVSPSTSAAVDDIEAEMRRLRLELKQTMEMYNTACKEALTAQQKAVELQRWKLEEEKKLEEARLAEEAALAIAENEKARSRAALEAAEAQKRIAELEAQKRLNAEMKAIKEAEEKKKAIDALSHLDIRYRKYSIEEIEAATEFFKESLKIGEGGYGPVYKCCLDHTPVAVKVLRPDAAQGRAQFQREVEILSCIRHPNMVLLLGACPEYGCLVYEYLSQGSLEDRLFRRGNTPSLSWQIRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPANILLNSNFGAKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYIDPEYQQTGMLGVKSDIYSLGVIFLQILTARPPMGLAHSVERSIEKGTFEQMLDPTVPDWPIEEAMSFAKLAIRCAELRRKDRPDLAKEILPELNRLRDLAYKDNPFFAVGNSLDAPSEGQVSLNMDSGPSS
Length757
PositionTail
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.08
Grand average of hydropathy-0.408
Instability index49.43
Isoelectric point6.25
Molecular weight84475.00
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23416
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     144.64|      35|      36|     366|     400|       1
---------------------------------------------------------------------------
  313-  349 (42.89/25.99)	NVSPSTSAAVDDIE.......aEMRRlRLELKQTMEM...YNTACKE
  350-  386 (35.65/20.41)	ALTAQQK....AVE..lqrwklEEEK.KLEEARLAEE...AALAIAE
  387-  425 (38.78/22.83)	NEKARSRAALEAAEaqkriaelEAQK.RLN....AEM...KAIKEAE
  426-  464 (27.32/14.00)	.EKKKAIDALSHLD.......iRYRKySIEEIEAATEffkESLKIGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     199.73|      59|      63|     139|     200|       2
---------------------------------------------------------------------------
  139-  200 (94.18/63.36)	KRFKVSDIPGSVTKGAPDFCTVYvVSKGKIQsmRSASRPAPPSVVQLSSEQTNLQVQMPPGW
  204-  262 (105.56/61.28)	ERFSYEGTPHRSQEGTTEFRSPF.TRKGYHD..RYTEHSAPDLDISFVSNGRPSSERMVPSF
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23416 with Med32 domain of Kingdom Viridiplantae

Unable to open file!