<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23414
| Description |
Uncharacterized protein |
| Sequence | MDLDDFRSILDTAGVDVWLFIDTAITVASLDCGDELRRRRDGIIERIFAATTPPLPCRNCDGDRNLRSNGHQIKKRLSPSPSPQRQHSHHQQRRGGRGAAAAVSPSTPQSLGDDDDNGHADADAAEDDREDLDPYGGLFDDEQKKILEIKEQLEEPDQSEESLVELLQNLADMDITFQALKETDIGRHVNRLRKHSSNDVRRLVKLLVRKWKEIVDEWVRLNQPGGAASLMADGDSPPLKTTQNGHHQIPDFAYSPNPHSEYLGILFKSSFCVSLLFWILANNNAFLLLYADTDGSSGSDRNTSEAEPKPKVIPRKEAPPKPTPPPSVPTPSIAFQNRQREQRDRDFDAERLASARKRLQENYKEAENAKKQRTIQVMDIHELPKSKPKNAFFGKNKGSGGSQGRHW |
| Length | 407 |
| Position | Unknown |
| Organism | Arachis hypogaea (Peanut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.868 |
| Instability index | 50.11 |
| Isoelectric point | 6.09 |
| Molecular weight | 45714.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23414
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.71| 14| 155| 78| 91| 2
---------------------------------------------------------------------------
67- 84 (21.95/10.42) RSNGHQIkkrlSPSPSPQ
242- 259 (23.76/11.83) TQNGHHQipdfAYSPNPH
---------------------------------------------------------------------------
|