<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23411

Description Uncharacterized protein
SequenceMAPPRGRGGAGGGFRGGRGDRGRGRGGGGGRGTPFKARGGGGRGGGGRGGGRGGRGGMKGGSKVVVEPHRHEGIFIAKGKEDALVTKNLVPGEAVYNEKRITVQKEDGTKDEYRVWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDVVGPNGVVYAVEFSHRSGRDLVNMAKKRTNIIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYYLRAGGHFVISIKANCIDSTVPAESVFASEVNKLKAEQFKPFEQVTLEPFERDHACVVGGYRMPKKKKDAE
Length302
PositionUnknown
OrganismArachis hypogaea (Peanut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
Aromaticity0.07
Grand average of hydropathy-0.417
Instability index33.11
Isoelectric point10.05
Molecular weight32134.29
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
RNA binding	GO:0003723	IEA:UniProtKB-KW
GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:UniProtKB-KW

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23411
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.45|      12|      15|       5|      16|       1
---------------------------------------------------------------------------
    5-   16 (27.76/ 8.80)	RGRGGAGGGFRG
   21-   32 (26.69/ 8.20)	RGRGRGGGGGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     137.07|      43|      88|      34|     114|       2
---------------------------------------------------------------------------
   70-  114 (66.09/61.64)	RHEGIFIAKGKEDALvtKNLVPGEAVYNEKRITVQKEDGTKDEYR
  234-  276 (70.98/18.41)	RAGGHFVISIKANCI..DSTVPAESVFASEVNKLKAEQFKPFEQV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.57|      27|      81|     118|     147|       3
---------------------------------------------------------------------------
  118-  147 (44.80/40.49)	PFRSKLaaaILGGVDNIW...IKPG.ARVLYLGA
  199-  229 (38.77/26.68)	PAKYRM...LVGMVDVIFsdvAQPDqARILALNA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23411 with Med36 domain of Kingdom Viridiplantae

Unable to open file!