<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23408
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTKPTNLKTKIKSPNRPKTERAKGVRTLVSPTDPLTPLLSSLHSPLSPLALSSHVSGLHLELPAQLPSSHHHCSRSHAPSPCQPSKIAATASATFRRAVRDCRRQLCSTLPPLQPPLASHCPYPRQLCIFPDFQLLTLGLVLVYLKILRILHWTPTQGSVVNSQILNEISQCVESFNAVKDGRWKATLTFYRPNLRDPTIPSEFPRDFLGISLLEQPNKYYFIIRGNKIILEADSTILTIMEKLQSYKSKVALNFEGVQYKMGDFQMKVVKVVPNQGESLRGILIEIEYLPISSIEKAKPIMEEFLELWREVMSKKSLPGHFSQAEPHFAEYKLPDNYTSQHTAIQYAAALAQLIASAHWLNSDTQWRRDWIPLNEGDCGDAHIALHSLKGTHVPLL |
Length | 397 |
Position | Head |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.229 |
Instability index | 50.48 |
Isoelectric point | 9.22 |
Molecular weight | 44682.23 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23408
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.82| 14| 15| 52| 65| 1
---------------------------------------------------------------------------
52- 65 (25.46/11.91) SS..HVSGLHLELPAQ
68- 83 (24.36/11.13) SShhHCSRSHAPSPCQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.26| 12| 18| 102| 114| 2
---------------------------------------------------------------------------
102- 114 (21.64/15.70) C..RRQLCsTLPPLQ
121- 134 (22.62/11.64) CpyPRQLC.IFPDFQ
---------------------------------------------------------------------------
|