<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23407
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTKPTNLKTKIKSPNRPKTERAKGVRTLVSPTDPLTPLLSSLHSPLSPLALSSHVSGLHLELPAQLPSSHHHCSRSHAPSPCQPSKIAATASATFRRAVRDCRRQLCSTLPPLQPPLASHCPYPRQLCIFPDFQLLTLDIASKILHWTPTQGSVVNSQILNEISQCVESFNAVKDGRWKATLTFYRPNLRDPTIPSEFPRDFLGISLLEQPNKYYFIIRGNKIILEADSTILTIMEKLQSYKSKVALNFEGVQYKMGDFQMKVVKVVPNQGESLRGILIEIEYLPISSIEKAKPIMEEFLELWREVMSKKSLPGHFSQAEPHFAEYKLPDNYTSQHTAIQYAAALAQLIASAHWLNSDTQWRRDWIPLNEGDCGDAHIALHSLKGTHVPLL |
Length | 391 |
Position | Head |
Organism | Arachis hypogaea (Peanut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
dalbergioids sensu lato> Dalbergieae> Pterocarpus clade> Arachis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.283 |
Instability index | 50.53 |
Isoelectric point | 9.08 |
Molecular weight | 43928.17 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.79| 29| 66| 13| 54| 1
---------------------------------------------------------------------------
13- 41 (51.82/33.54) SPNRPKTERAKGV...........RTLVSPTDPLTPLLSS
80- 119 (45.97/13.30) SPCQPSKIAATASatfrravrdcrRQLCSTLPPLQPPLAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 148.67| 50| 71| 204| 258| 2
---------------------------------------------------------------------------
204- 258 (71.76/74.07) GIsLLEqpNKYYFI..IRGNKIILEADSTIL.TIMEK..LQSYKSKVALNFegVQYKMGD
276- 330 (76.91/58.07) GI.LIE..IEYLPIssIEKAKPIMEEFLELWrEVMSKksLPGHFSQAEPHF..AEYKLPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.73| 13| 15| 42| 56| 3
---------------------------------------------------------------------------
42- 54 (23.69/14.96) LHSPLSPLALSSH
58- 70 (24.05/ 8.68) LHLELPAQLPSSH
---------------------------------------------------------------------------
|