<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23405
Description |
Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MCVTNYDITQIHLSYSRFKQETIRAAGMNISNNANIDQGIKHAGDISNTKFEESFEKFFSVCDQMELHLKTAIDHSLQNVASQHHTPSQINPSAGDNQKYAHYISTIKSQVSYVKEIHSELVNSTANVSNISSRTSADQIASMETSS |
Length | 147 |
Position | Tail |
Organism | Armadillidium vulgare (Pillbug) (Pill woodlouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Multicrustacea>
Malacostraca> Eumalacostraca> Peracarida> Isopoda> Oniscidea> Crinocheta>
Armadillidiidae> Armadillidium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.530 |
Instability index | 41.55 |
Isoelectric point | 6.02 |
Molecular weight | 16355.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23405
No repeats found
|