<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23399
| Description |
Mediator of RNA polymerase II transcription subunit 29-like protein |
| Sequence | MKVTALNINHNSQIDSGVKTTEDKVARFDKALEEFFASCNQIELLLKTINECAIQHRDSQKYLQFNVSTLKSDASGTIENCGPDTVISYSQYISTIKNQIHFAKSVQDVLIEGAKRVTLNEPPMNQTSMTNAQTS |
| Length | 135 |
| Position | Tail |
| Organism | Leptotrombidium deliense |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Anystina> Parasitengona>
Trombiculoidea> Trombiculidae> Leptotrombidium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.419 |
| Instability index | 39.25 |
| Isoelectric point | 5.88 |
| Molecular weight | 15043.77 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23399
No repeats found
No repeats found
|