<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23394
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAATSAYPPPPPYYKLYKDYHQNPKSAPEPPPPIHGTYSLFGANYTTDDLLPSLEEQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKESLATLDGNLS |
| Length | 171 |
| Position | Middle |
| Organism | Cinnamomum micranthum f. kanehirae |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Magnoliidae> Laurales> Lauraceae> Cinnamomum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.684 |
| Instability index | 67.69 |
| Isoelectric point | 9.07 |
| Molecular weight | 19778.36 |
| Publications | PubMed=30626928
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23394
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.46| 16| 19| 5| 23| 1
---------------------------------------------------------------------------
5- 20 (36.16/19.47) SAYPPPPPY...YKLYK.DY
26- 45 (25.31/ 6.38) SAPEPPPPIhgtYSLFGaNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.60| 27| 45| 75| 113| 2
---------------------------------------------------------------------------
75- 107 (32.78/39.23) LRSLN.RELQLHILELaDVlvERPSQyarRVEDI
121- 148 (43.82/19.00) LRPHQaRATLIHILEL.QI..QRRKQ...AVEDI
---------------------------------------------------------------------------
|