<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23378
| Description |
Putative mediator of RNA polymerase II transcription subunit 26b |
| Sequence | MDRTSGKLDYWRNYFRSANSDIFEVIEYAILVAASDCPQELQMRRDRIAERLFSCRLTRCNGCDHVEIAVPCEGEEEGNGGFKGGFVGEGGSKESKVNSSTNERGEVNRVSNYSYDEAEALTEEIEEESEIVGEVLRIKEVLGNHREESDGVLFESLRRLQLMGLTVETLKATEIGKAVNGLRKHGSKQIRLIAKTLIDAWKHMVDEWVNAVAAISGRNFLFKDFPFLFQSLYCDSDDIYKYLYLFMVAGGTPESVNPTPESVNPSVVDEEEEGLPSPPLDEGALFATQTTMELSQSVVDFVTDPRNTLELNKKREFGRKPGSENYDRKRNQQTLNETSVLKDDKSQMRKQEAVIKQTKPSTSNFGPGRPPKLSSDHKATGDSKLPQRVDPLVVQKKRPTSEQDKSIYSDDLVRLKLEASGRNLQERYQQLENGKAYRQRTIQVMELRDLPKQVSTQRNFHLKPGIHNRHWANGRR |
| Length | 476 |
| Position | Unknown |
| Organism | Cinnamomum micranthum f. kanehirae |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Magnoliidae> Laurales> Lauraceae> Cinnamomum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.761 |
| Instability index | 44.91 |
| Isoelectric point | 5.93 |
| Molecular weight | 54045.97 |
| Publications | PubMed=30626928
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23378
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.57| 14| 15| 291| 305| 1
---------------------------------------------------------------------------
291- 305 (20.19/16.35) TMELSQSvVDFVTDP
308- 321 (24.38/14.84) TLELNKK.REFGRKP
---------------------------------------------------------------------------
|