<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23368
Description |
Uncharacterized protein |
Sequence | MNQTINVEQLNSALTSLRTLRLSVSHVFDTLSNGLRADHGEEGKDKFLLELQELLNNVNTNLRDLEQTVSGLPIPTAPFNLGNTTFLSQETTQDRQALYTQLVNSYKWTDKIHEYSSFAHTLLSQNSLKRSYINSGSTKRRGKLQSNHNVAPLQVDNVINNIDRSYNDMKITISRPFASNAVVQINLSHVLKAVVAFKGLLMEWVMVKGYGETLDLWTESRHHVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWLHSYVNLFSEPCKRCGCHLHHVSLLPPAWRDFRTLEPFHDECKQ |
Length | 299 |
Position | Tail |
Organism | Chilo suppressalis (Asiatic rice borer moth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Pyraloidea>
Crambidae> Crambinae> Chilo.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.368 |
Instability index | 42.75 |
Isoelectric point | 8.31 |
Molecular weight | 34218.45 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23368
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.75| 18| 102| 49| 70| 1
---------------------------------------------------------------------------
8- 25 (29.20/11.20) EQLNSALTSLRTLRLSVS
53- 70 (30.55/13.10) ELLNNVNTNLRDLEQTVS
---------------------------------------------------------------------------
|