<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23364
Description |
Uncharacterized protein (Fragment) |
Sequence | QIELGRTLRAIVVLRGLMIEWVKVKGFDESFKNEDGQVCILVRAYSECFSLVTDNAEAASLRFYAPAMPQLAIKSFIHWLQGYKTLFSAPCVKCGKYLQNNMPPTWRDYRSKDPFHDVCRA |
Length | 121 |
Position | Tail |
Organism | Elysia chlorotica (Eastern emerald elysia) (Sea slug) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Heterobranchia> Euthyneura> Panpulmonata> Sacoglossa> Placobranchoidea>
Plakobranchidae> Elysia.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.118 |
Instability index | 51.24 |
Isoelectric point | 8.87 |
Molecular weight | 13909.03 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23364
No repeats found
No repeats found
|