<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23352
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MSADYWSSSQRNKWQLTRFSLLEARRKVLLLERKMIQNGLIKDYGNIIYDYNMRIYLHNLLIKLGRRLNVRQVALATAEVYLTRFLTRVSLKEINVYLLVTTCVYVACKIEECPQHIRLIINEARNIWPEYIPHDITKLAEFEFYLIEEMDSYLLLHHPYKSLIQIRDYLHENYSIFGLKFSDEELQNAWSLINDSYITDLHLLVPPHIISMAAIYITIVLKKNLAQIRRGGATVNSGGDESKPDVKELDSKIMNIDDLMNLTKASTGSSSSQEATTQQPTATTTTTTNFQDDLNILDEDTIKINKFMNFLDHSHINLDEMVEAMQDIINLYVLWNRYNEQGVKKALQVMLLTR |
| Length | 354 |
| Position | Kinase |
| Organism | Spathaspora sp. JA1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Spathaspora>
unclassified Spathaspora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.201 |
| Instability index | 45.60 |
| Isoelectric point | 6.08 |
| Molecular weight | 41233.02 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23352
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.22| 35| 64| 122| 167| 1
---------------------------------------------------------------------------
122- 167 (47.71/64.50) NEARNIWPE....YI.......PHDITKLAefEFYLIeemdsyLLLHhpyKSLIQIR
184- 229 (50.51/34.22) EELQNAWSLindsYItdlhllvPPHIISMA..AIYIT......IVLK...KNLAQIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.89| 15| 66| 248| 262| 2
---------------------------------------------------------------------------
248- 262 (24.73/16.75) ELDSKIMNIDDLMNL
296- 309 (18.21/10.51) ILDEDTIKINKFMN.
317- 331 (23.96/16.01) NLDEMVEAMQDIINL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.73| 13| 15| 68| 82| 3
---------------------------------------------------------------------------
68- 82 (16.28/19.10) LNvrQVALATAEVYL
86- 98 (21.45/15.89) LT..RVSLKEINVYL
---------------------------------------------------------------------------
|