<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23349
| Description |
Uncharacterized protein |
| Sequence | MSVSAQNYATNIASSQPPSQATSQPANLSSPPSSAPMSTQTSQQPTVGATNSFPTPASSVSGHFMGPTSVEDSEHAGTSFEHVQADSVATTATGLHSSSTQQSEHRRTDHDREVEGPTPGIDVRDFASMGGPHTRSDTDAMDIDKDAIASAKSDGLSLESLQQDFSSAFHLCKSSHIATGPDPALDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPSAPGGLRHLTMWPEEEWQNQKVYGKEIKVADIDSALYNLQMKAMQMEPGTVPNNEYWEDVLGHEKPSKHAGHGDGKKAATLPNTARSPSQANETPLPTEPERARPSRGRKRHYDDNSFVGYGEGYADDDDDAAFYSNSEGIGKKKRKKVRSHAIWDGSWTRLIVLVFPKEHVSKVSTPLPDRGGSYGVGMFGIGAR |
| Length | 434 |
| Position | Head |
| Organism | Aspergillus turcosus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.749 |
| Instability index | 44.53 |
| Isoelectric point | 6.28 |
| Molecular weight | 46671.99 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23349
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.90| 23| 26| 38| 60| 1
---------------------------------------------------------------------------
38- 60 (40.13/19.59) STQ....TSQQPTVGATNSFP.TPASSV
61- 88 (24.14/ 8.97) SGHfmgpTSVEDSEHAGTSFEhVQADSV
105- 123 (29.63/12.61) HRR....TDHDREVEG....P.TPGIDV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.12| 14| 68| 229| 242| 2
---------------------------------------------------------------------------
229- 242 (27.83/15.00) GRNKPVKHDPSAPG
300- 313 (28.29/15.37) GHEKPSKHAGHGDG
---------------------------------------------------------------------------
|