<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23345
| Description |
Uncharacterized protein |
| Sequence | MMISIETLQEDISRLRELKERMQRVRQVPPTLMKGTEKMGEEFAAVREIGQHVVSDDTQRALLRARDSLAEDGTDVWAVGRREKRKRTRGRSPEAYMEESRETSSSTTELPHSTEEGVRQDGLAEWARAYNSTHKNKIRIKGRTLRMTIPDVMTVYMGIGAQERVVVETIRAFGPREMTEGLGQSVYGVYRQLSQQLNSVLEEQMSLQTVVCVAEAYESVFVSRCMVCGRVVGGEGHVPGLVRRWTGRSWVVEHIGCVIGV |
| Length | 261 |
| Position | Tail |
| Organism | Psilocybe cyanescens |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Psilocybe.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.461 |
| Instability index | 57.01 |
| Isoelectric point | 8.36 |
| Molecular weight | 29514.39 |
| Publications | PubMed=30283667
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 89.46| 21| 51| 71| 91| 1
---------------------------------------------------------------------------
41- 64 (25.76/15.14) EEFAAVR..EIGQHvvsDDTQ.RALLR
71- 91 (36.84/24.55) EDGTDVW..AVGRR...EKRK.RTRGR
120- 143 (26.86/16.07) QDGLAEWarAYNST...HKNKiRIKGR
---------------------------------------------------------------------------
|